CAZyme Information: MGYG000000176_05266

Basic Information

• Species: Muricomes oroticus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes oroticus
• CAZyme ID: MGYG000000176_05266
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
804	MGYG000000176_44|CGC1	94003.41	5.9462

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000176	5921397	Isolate	China	Asia

• Gene Location: Start: 143; End: 2557 Strand: +

Full Sequence      

MGKNISHSGIMIQILENRGESEHFHEDLEVLYVLEGKMEVTVNQVKTELGAEDVFLVNAN
MLHSLNGSEGTLCACISMRYELMKEILNRQAIAYYCDSTKDDSSSYTELRRLIRRLLRQY
LDVQEGLYGFGYHISCYQLMEYLSTHFLMDLSDGTDGEQGDKFKERLEQINSYIHQNYNK
QINLKDLANQMYLSVGYLSRFFKKYYGSSFTDYLNGVRLTYGMDSLLYTNKRITEIAMDC
GFPTIASFHKAFKKRYGEIPSAVRKRNTEKINKLSDWNHVEISQRLEKIIWNQQSGRKED
KSRIVCTCSASDTSPLVQNWNDTINIGEAQDLLPNEMQVHLMMLKSALNFKYVRFWSPFT
PEMMIDINNPEHIFNFSRLDTVLDFLLQNNLIPHIEIMNKPKRLQKNSKMPIINRDREGA
ASLENWDLLINAFMVHITERYGKSKISHWRIEVWSSESHWEDGNEYDDYFTIFQHTKEII
KKHSPGVCVGGCGMQAYSRGNDYPDLIKEFYTRWKERDCLPDFISFMSYAYYKDRYEAHS
QFKRNTDSSFVVHGLNEVKKILKEISLDDIPVYITEWNHSVSDRNYLNDSCYKGAQILQS
YFEVYGQTSVMAYFIGSDRYSEFYDTDTLLFGGAGLISRDGILKPSGFAFDFLNRLSPGF
VAKDRNYMVTTDGESTVSILCHNAKELNYTYFNTEEDKIEKEHLERYYEDTESLQLQIQL
TGLPDGGYQMKRYSINEQYGSVLDIWGNMEYEKRLSINDIKYFRRICEPYLSIHTCYVEN
GAITLEIELYANEISLIVLQKRKH

Enzyme Prediction     

No EC number prediction in MGYG000000176_05266.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	314	749	1.1e-67	0.9767981438515081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.83e-38	310	802	8	490	Glycosyl hydrolases family 39.
COG2207	AraC	8.07e-28	165	272	20	127	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	1.11e-23	181	264	1	84	helix_turn_helix, arabinose operon control protein.
COG3664	XynB	3.10e-23	332	797	1	422	Beta-xylosidase [Carbohydrate transport and metabolism].
pfam12833	HTH_18	6.81e-21	187	266	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIB55960.1	3.08e-191	12	800	9	798
QMW76172.1	3.08e-191	12	800	9	798
BBG22497.1	3.13e-177	1	801	1	807
AQR96769.1	4.04e-177	1	797	1	796
AGF58080.1	4.50e-176	1	797	1	796

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFG_A	3.62e-36	318	801	16	482	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
2BS9_A	4.88e-36	318	801	16	482	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	2.16e-35	318	801	16	482	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
6UQJ_A	8.60e-33	332	800	43	504	Crystalstructure of the GH39 enzyme from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
4M29_A	1.89e-32	332	800	38	497	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	1.85e-32	318	801	16	483	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
O30360	4.26e-32	320	802	18	482	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	2.75e-29	320	802	18	482	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
P23552	6.57e-25	320	657	24	357	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
Q6GKK1	4.90e-19	28	801	23	741	Uncharacterized HTH-type transcriptional regulator SAR0107 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=SAR0107 PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000176_05266.