CAZyme Information: MGYG000000179_00966

Basic Information

• Species: Enterocloster aldenensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster aldenensis
• CAZyme ID: MGYG000000179_00966
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000179_1|CGC11	42471.76	5.6296

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000179	6044848	Isolate	China	Asia

• Gene Location: Start: 1053806; End: 1054927 Strand: -

Full Sequence      

MWLEYFSQYMETAFPRFLSERPWNYKNDLCVTGAAMLADATGSPRWNRYILDAAKWLVDE
EGRVANWKEYEHNIDKVSFGKSLRILRDLTGDGRYGRGVERAYAFLEHYPRTSTGNFWHK
DIYPDQVWLDGLYMAMPFYAKCLAENGEERWDDIMDQFQSTHRLLWDGKTGLYLHGCDVS
RKADWADPATGRSPGVWSRAEGWFLMALADVYELAKDYTPRAGELVVLLKNGLDGLLQYQ
DRESQMFLQVVDHAGLPGNYPETSGSAMAAYALMKGVRLGMLDGSYWDKGSEVLEGIRRT
WLKKEEDGWHLHGICASAGLGAGPDPHNRKDRNGTPEYYISEAQMPDNQHGAAACMMAVS
EQLRRKGNQPCSN

Enzyme Prediction     

No EC number prediction in MGYG000000179_00966.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	20	363	9.6e-85	0.9668674698795181

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	5.47e-69	4	364	14	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.39e-63	23	366	27	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQQ99429.1	2.09e-266	1	373	1	373
ANU45824.1	2.09e-266	1	373	1	373
QIX93226.1	1.92e-262	1	373	1	373
ADL69867.1	1.39e-91	23	366	22	361
AFK85204.1	4.44e-90	23	364	22	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.49e-74	23	361	23	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.14e-55	23	361	39	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.83e-55	23	361	29	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4Q88_A	3.70e-12	25	287	39	296	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3QWT_A	9.92e-08	23	297	65	328	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.22e-55	23	361	39	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.37e-39	134	363	1	229	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.37e-39	134	363	1	229	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000179_00966.