CAZyme Information: MGYG000000181_00325

Basic Information

• Species: UBA9414 sp003458885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA9414; UBA9414 sp003458885
• CAZyme ID: MGYG000000181_00325
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	MGYG000000181_3|CGC3	71668.61	7.4672

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000181	2690153	Isolate	China	Asia

• Gene Location: Start: 78205; End: 80052 Strand: +

Full Sequence      

MSDKKKPEYRIAWMKVLRKLSIYNIKKGLLYLRHYGLKEFWFRMKERFQAEAADYGKWYE
NHKASEEELAKQRKEHFAKEPLISILVPVYNTPREFLIQLLRSVGTQTYHNWELCIANAS
VDNKGVIEVLEHYQEKTKRLKVINVPENEGISQNTNKALSIASGEYVALLDHDDLLAPNA
LYEIVKVINNKEDADVIYTDEDKVTADLKEHFQPHFKPDFSEDLLRSNNYICHFFVAKRE
IVNEVGGFHPEFNGAQDYDLIFRCTEKARGIYHVPKILYHWRTHKASTADNPASKMYAFD
AGKRAIEEHLKRVGEKGEVSHTKDLGFYRVKYPVIGNPKVSIIIPNKDEIASLEKCIHSI
REKTDYKNYEIIVVENNSEKSETFEFYKKIERDWLKVIYWDREFNYSAINNFGVRHATGD
YLLFLNNDVEVINSDWMTEMLSHCQRKHVGVVGAKLYYPDNTIQHAGIVIGIGGIAGNMF
TGMSRSFTGYLHKASIQQDLSAVTAACMMVERHAFEKVKGFEEDLAVAFNDVDFCLKIRK
AGYLIVYNPNVELYHYESKTRGKEDTKEKLKRFQGEIDYMKERWSQILEQGDPYYNVNFS
LIKCDYSLKNNDRKS

Enzyme Prediction     

No EC number prediction in MGYG000000181_00325.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	341	518	3.6e-25	0.9882352941176471
GT2	84	245	5.4e-23	0.9882352941176471

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	3.55e-108	81	283	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.25e-41	342	557	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd06433	GT_2_WfgS_like	2.08e-30	84	288	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.61e-30	336	563	1	227	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	4.15e-22	84	242	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUO33453.1	0.0	1	615	1	615
QCU01342.1	1.78e-281	10	609	9	609
QIB58022.1	9.73e-281	10	612	5	608
QMW77454.1	9.73e-281	10	612	5	608
CBL21583.1	1.02e-280	10	609	9	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	3.62e-09	82	196	6	118	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	4.23e-07	81	205	5	125	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.35e-144	81	608	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.58e-102	13	609	256	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	7.65e-18	81	264	8	194	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q7BLV3	1.03e-15	76	464	435	866	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2
Q9CMP0	1.35e-15	76	464	428	859	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000181_00325.