CAZyme Information: MGYG000000183_00356

Basic Information

• Species: Butyricimonas paravirosa
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas paravirosa
• CAZyme ID: MGYG000000183_00356
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000000183_2|CGC1	45772.09	7.7324

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000183	5449115	Isolate	China	Asia

• Gene Location: Start: 10524; End: 11732 Strand: +

Full Sequence      

MGGLKYGMEYRPYYLAKEWVKMGHQVTLVGASFSHLRIQQPVVTTNKDFEEETVEGINYI
WIKTPAYESTFARIQNIFVFVCKLWKYSRKISEFVKPDLVVASSTYPLDIYPARKIAETA
GAKLCYEVHDLWPLSPKLIGGYSSWHPFIIVMQLAENYAYKHVDKVISLLWNSEQHMREH
GLAEGKFKCIPNGYCKEDWENLNLKEEIPQTHKLLFKQLENKIIVGFAGGFAASGSLDTL
VKAAALLKEHDNLAFVLVGKGPEQEYLEKLVKERSLANTFFLPAVKKIQIPRIVAYFDVA
FIGGIHSFLHKYGTSANKLTDYMLSAKPIIQAIDEPNSVIERVKCGICVEAENERLVADA
ILELTGMTREKREKMGEGGRKYALENLEWGILAKQFLDEFAK

Enzyme Prediction     

No EC number prediction in MGYG000000183_00356.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	1.36e-85	5	397	13	391	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	1.08e-21	7	400	15	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.70e-21	50	402	43	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
PRK10307	PRK10307	3.11e-19	96	401	106	406	colanic acid biosynthesis glycosyltransferase WcaI.
cd03807	GT4_WbnK-like	1.34e-18	178	382	149	343	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBE18882.1	2.52e-134	8	398	1	390
AYA78044.1	2.15e-123	6	398	15	405
ACI19561.1	3.14e-123	2	398	11	405
QQA31405.1	5.18e-119	7	398	16	400
BBK88696.1	5.18e-119	7	398	16	400

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000183_00356.