CAZyme Information: MGYG000000183_01081

Basic Information

• Species: Butyricimonas paravirosa
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas paravirosa
• CAZyme ID: MGYG000000183_01081
• CAZy Family: GH84
• CAZyme Description: O-GlcNAcase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
737	MGYG000000183_4|CGC3	84870.35	5.49

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000183	5449115	Isolate	China	Asia

• Gene Location: Start: 118110; End: 120323 Strand: -

Full Sequence      

MKKVLVFFVCLLLIQVRVMAQDIKVQPSPRQVNVTGKSMTIPVAFRLVGEQEANPHAIAL
LKQFLGDRLGTEGFPLYVGEKGDRAVRGAKRLIPDHPEGYYLSITDKAIMLAGNDERGTY
YAVRTFMQLFHEGHLPFVGIQDYPDVRFRGVVEGFYGTPWSHEARLRQLQFYGENKLNTY
IYGPKDDPFHSSPNWRKPYPAKEAARLAELVKVANENEVDFVWAIHPGLDIRWETSDRDS
LMAKFEHMYDLGVRSFAVFFDDISGEGAKADRQVELLNYIDDHFVQVKPDVTPLIVCPTE
YNKGWARPESGYLATIGEKLNPSVEVMWTGDRVISEITREGVEWIREQIKRPSYIWWNFP
VSDYVRDHLLLGEVYGNGKDIAGSISGFVANPMEWAEASKLAIYCVADYTWNMQSYDRFR
SWYRAIRAIMPENVEAFTVFARHNSDLGENVHRFRREESVEIQPVAERFMKGYREGHYDE
RDFLALQDEFERVAEAADLLLIDRENEALIEEITPWLHQFKILGDAGQEALAMIKAGERG
DRELFLRKYNHVKALRKRSYELERQFNQNPYQPGVKTGTTVLQPLVLDVFTEATERFNRQ
NGTDLPLLADYSPCKLTTNVPQLEHLPLQVYPSRVHLTPLLEVVKWPAGGYLQLELDDAY
RIPGTRLNFDVKGDLSWGVMEVSADGETWQTVTLTRDARGRLNGKWEDTPVKFVRFTNTG
EGEQQVYLREFYVVFSL

Enzyme Prediction     

No EC number prediction in MGYG000000183_01081.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	149	441	1.3e-110	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	9.73e-165	149	440	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam18344	CBM32	8.07e-18	605	670	1	64	Carbohydrate binding module family 32. This domain is found in GH84C present in Clostridium perfringens. GH84C is a beta-N-acetylglucosaminidase. This domain is a family 32 carbohydrate binding module (CBM) which preferentially recognizes the non-reducing terminus of N-acetyllactosamine.
pfam02838	Glyco_hydro_20b	2.46e-14	22	142	1	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO48327.1	0.0	1	737	1	737
AZS29316.1	0.0	1	736	1	736
QQT77482.1	0.0	20	731	21	730
ASM65960.1	0.0	20	731	21	730
QRP57274.1	0.0	20	731	21	730

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	1.15e-315	2	731	4	730	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	4.88e-315	20	731	3	712	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2J47_A	6.21e-315	21	731	1	709	Bacteroidesthetaiotaomicron GH84 O-GlcNAcase in complex with a imidazole-pugnac hybrid inhibitor [Bacteroides thetaiotaomicron VPI-5482],2W4X_A BtGH84 in complex with STZ [Bacteroides thetaiotaomicron VPI-5482],2W66_A BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W66_B BtGH84 in complex with HQ602 [Bacteroides thetaiotaomicron VPI-5482],2W67_A BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2W67_B BtGH84 in complex with FMA34 [Bacteroides thetaiotaomicron VPI-5482],2WCA_A BtGH84 in complex with n-butyl pugnac [Bacteroides thetaiotaomicron VPI-5482],2XJ7_A BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XJ7_B BtGH84 in complex with 6-acetamido-6-deoxy-castanospermine [Bacteroides thetaiotaomicron VPI-5482],2XM1_A BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM1_B BtGH84 in complex with N-acetyl gluconolactam [Bacteroides thetaiotaomicron VPI-5482],2XM2_A BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],2XM2_B BtGH84 in complex with LOGNAc [Bacteroides thetaiotaomicron VPI-5482],4UR9_A Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],4UR9_B Structure of ligand bound glycosylhydrolase [Bacteroides thetaiotaomicron],5FKY_A Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FKY_B Structure of a hydrolase bound with an inhibitor [Bacteroides thetaiotaomicron],5FL0_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL0_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_A Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron],5FL1_B Structure of a hydrolase with an inhibitor [Bacteroides thetaiotaomicron]
2WZH_A	6.58e-315	2	731	4	730	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	6.58e-315	2	731	4	730	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	6.27e-315	2	731	4	730	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q8XL08	2.08e-108	27	545	48	583	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
Q0TR53	4.03e-108	27	545	48	583	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
P26831	4.27e-54	70	559	97	619	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	3.54e-44	150	420	63	340	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000189	0.999185	0.000150	0.000159	0.000145	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000183_01081.