CAZyme Information: MGYG000000183_02524

Basic Information

• Species: Butyricimonas paravirosa
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas paravirosa
• CAZyme ID: MGYG000000183_02524
• CAZy Family: PL12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
659		77240.68	6.7978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000183	5449115	Isolate	China	Asia

• Gene Location: Start: 200678; End: 202657 Strand: -

Full Sequence      

MNFIPKYIFFTKLLIVLNDYYNRLLFLVPVCFIRPKRYKNIVNNISKEELAQRLKSTLGD
FNYFLQQCGKHPDIEVIIHDANNTLNHHFEVLGSGLITSDPIDWHCDFKSGFKWPYGKYY
KKYIRVNKGDNSDVKVPIELSRCHHLLWLGEAYLITHDDKYSSEVVNEICDWINENPYAY
SINWSCTMDVAIRAVNWMYALNMVIDSKIVDDKFCKQVTRSLLEHVYFIYHNLEKGAPYS
GNHYASNLSGLIFLGLLFKDIPSIRKYFDFGLFELYREIRNEVLPTGVHYEKSISYHRLM
VELFAYPVFLLQKTGFDVPLDICYRVKSMFNFVHSYTKPDGTAPMIGDNDDGRLLPFVKY
AFNYHAYLRSVAYCKYKDRVYESLPSIDSFFLFPEICFLTSDSSVKLLPIKTKLFLDAGF
AVLRNEEFYVFFNGSGIGMYYAELKKSVIATHNHADLLSFDLSLGECNVFVDAGSYVYTS
SLQAHNEFRSTKKHNTVNIDNLDQYHIEQDKFWAYSNFKMPSVLEYSNMLQCQKISGEYC
WFFPEDTVRHKRTIEVYGDRMFVIDEFKCVNEHLFQACFMLDPGIRVESVNHDVIELFHP
ELGRRLRLMVGDIDHVDIRIEVDRVSFSYGCLNETSKIIMEFRQKGTFRYSLKIVPINE

Enzyme Prediction     

No EC number prediction in MGYG000000183_02524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL12	418	565	1.1e-28	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07940	Hepar_II_III	2.58e-24	413	639	7	219	Heparinase II/III-like protein. This family features sequences that are similar to a region of the Flavobacterium heparinum proteins heparinase II and heparinase III. The former is known to degrade heparin and heparin sulphate, whereas the latter predominantly degrades heparin sulphate. Both are secreted into the periplasmic space upon induction with heparin.
pfam16889	Hepar_II_III_N	8.94e-23	142	348	101	316	Heparinase II/III N-terminus. This is the N-terminal domain of heparinase II/III proteins. It is a toroid-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT39999.1	8.86e-118	47	642	43	613
ASS92252.1	3.36e-94	70	646	42	614
QIZ45027.1	8.12e-93	60	641	67	644
QWU47774.1	1.23e-91	70	641	76	642
AXK21098.1	3.72e-91	75	641	82	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JMD_A	6.05e-15	132	519	110	505	HeparinaseIII-BT4657 gene product, Methylated Lysines [Bacteroides thetaiotaomicron VPI-5482]
5JMF_A	4.23e-14	132	503	110	474	HeparinaseIII-BT4657 gene product [Bacteroides thetaiotaomicron VPI-5482]
4FNV_A	1.74e-07	139	658	157	663	CrystalStructure of Heparinase III [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89YR9	9.55e-07	139	658	157	663	Heparin-sulfate lyase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=hepC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999896	0.000122	0.000011	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000183_02524.