CAZyme Information: MGYG000000183_03434

Basic Information

• Species: Butyricimonas paravirosa
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas paravirosa
• CAZyme ID: MGYG000000183_03434
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42890.78	8.7903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000183	5449115	Isolate	China	Asia

• Gene Location: Start: 103746; End: 104882 Strand: -

Full Sequence      

MKYYVIAGEASGDLHASNLIKGLRKFDLDAKVRGWGGDLMREAGCEIVRHYKDTAIMGFL
TVLKNLDKIKANIDACHQDILVWQPDVVILVDYGGFNLRVAKFIKDANIPVFYYISPKIW
AWNTGRVKKIKRLVDRMFVIFPFEVDFYARYDYPVQYAGNPLVDAIHDRPFKNETFNEFV
QVNGLSGKPIIALVAGSRSQELKHVLPKMLTMVKHFPDHEFVIAGAPSMSDEDYAPYLQD
VKVRIIYGQTYRLVRQARAALVTSGTATLETAILRTPQVVCYSGEGGALSYFLFKTFVKV
KYISLVNLIAGREVVTELLMQKLNEKNLLRELSAILPEGGKRHQMLDGYDEVNEKLGDAG
ASERFARMMIDELSQFRE

Enzyme Prediction     

No EC number prediction in MGYG000000183_03434.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	356	3.6e-116	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	3.17e-114	1	375	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.58e-107	1	375	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	9.64e-81	4	357	2	360	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.68e-68	5	371	10	384	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	4.44e-55	1	369	2	344	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO51639.1	3.30e-261	1	377	1	377
AZS31618.1	5.47e-260	1	378	1	378
ADY31424.1	1.37e-193	1	370	1	370
SNV26174.1	1.37e-193	1	370	1	370
BAX81022.1	1.38e-147	1	375	1	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	1.50e-45	5	375	11	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	2.10e-45	5	375	11	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	5.17e-76	5	375	11	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q39T49	2.61e-73	5	377	11	384	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
Q74AT9	3.20e-71	5	375	11	382	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1
Q1D393	3.45e-70	5	373	9	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	7.57e-69	5	370	8	375	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000183_03434.