CAZyme Information: MGYG000000183_03559

Basic Information

• Species: Butyricimonas paravirosa
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Butyricimonas; Butyricimonas paravirosa
• CAZyme ID: MGYG000000183_03559
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658	MGYG000000183_20|CGC3	75884.75	4.7603

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000183	5449115	Isolate	China	Asia

• Gene Location: Start: 54687; End: 56663 Strand: +

Full Sequence      

MKYIWLFVILLCGCAGQSFLNVQADYRNVLNISNWPQGIREGVSLFSDLGAWHGFAFIPD
SVGMAGGFSGPMSMASNYAVGSYTAVASVVVDGVLQEVTNAIVEKSYFPGRMIQSFTWET
LTLTQEIVFVNNRTSLLRTRVRNTGGPKEVKIIYEGSFFTQYFQGQVIDGRTVYLEFPAT
KCCFEIEAGEGCHAVVRDGKYRFETEVRKFGRGEEREDMFVYSAYFNDEPEHVKHPVLEE
NPFEESEPFFEMAAQRWERYIEKLFENKSELFTNLKYRRIAVKCLMTLMANWRSAAHDLL
HDGGYPSYWGFSTGFWSWDSWKIAAAIGRWEPELAKDHIRALFDYQTEEGMIPDFVSRIK
YINNLRDTKPPLASWAVEEIYDADGDLSFVEEMFDRLLRYHNWWYAYRDVDQNGLCEYGA
TDGTLQAAAWESGMDNAVRFDSTEMLKGELPKAWSMSQESVDLNTYLYDEKMTLARFARL
LNREEFANQLEKDAGILADRIRQIMFDDENGYFFDVRLKSHALIPVYGPEGWLPLWAGVA
NQKQADQVRNIMMDVNRFNSFVPLGTLDLSHPRLEPERGYWRGPVWLDQAYFGIRGLRNY
GYDKEANELTLKILNNCQGLLGDQPIHENYNPLTGETLNAPHFGWSSAHLLLMMFEYK

Enzyme Prediction     

No EC number prediction in MGYG000000183_03559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	211	656	1.7e-100	0.5421052631578948

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.47e-149	9	653	14	779	alpha-glucosidase; Provisional
COG3408	GDB1	2.07e-21	304	656	275	605	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.04e-19	345	657	146	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	2.67e-13	428	654	324	549	Neutral trehalase [Carbohydrate transport and metabolism].
PLN02567	PLN02567	1.54e-11	318	541	156	421	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD44200.1	1.66e-193	13	654	23	669
QUT85676.1	1.93e-188	17	656	28	688
AII65461.1	1.93e-188	17	656	28	688
QJR78111.1	1.93e-188	17	656	28	688
ABR38022.1	2.73e-188	17	656	28	688

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	6.10e-94	25	653	4	752	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.25e-93	25	653	4	752	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	4.54e-93	25	653	4	752	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	5.28e-89	25	650	5	750	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	2.31e-46	427	653	42	301	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	5.47e-93	25	653	27	775	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	7.92e-24	272	656	63	487	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	4.52e-23	316	656	98	487	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P49381	1.21e-08	431	614	477	660	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
B6I9Q8	5.35e-08	461	654	335	529	Periplasmic trehalase OS=Escherichia coli (strain SE11) OX=409438 GN=treA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000087	0.090667	0.909164	0.000027	0.000038	0.000034

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000183_03559.