CAZyme Information: MGYG000000187_00342

Basic Information

• Species: Lachnospira sp003537285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp003537285
• CAZyme ID: MGYG000000187_00342
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000000187_3|CGC1	27983	6.7488

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000187	2804290	Isolate	China	Asia

• Gene Location: Start: 94134; End: 94886 Strand: -

Full Sequence      

MNCLPRTKERGFQHVTSANGDRQGVRLNENEMWIDTLFMTVLFLNKMGQKYNRQDWINES
IHQVLMHIKYLCDNKTGLFYHGWTFNEMNNFGGIFWCRGNSWFTLGILDYVDMFKGTLNS
GVKEIIIDAYKAQTAALKKLQSKSGLWHTVLTDSSSYEEVSGSAAITAGILKGIRMGILD
DSYIDVADKAINAILKNIDSDGTVLNVSGGTGMGYDAEHYKNILIAPMAYGQSLTILALV
EALQNDKKSI

Enzyme Prediction     

No EC number prediction in MGYG000000187_00342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	2	243	8.1e-80	0.7108433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	4.01e-72	5	245	115	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.45e-67	1	243	105	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR73371.1	1.29e-182	1	250	145	394
QRT30792.1	5.23e-154	1	244	128	371
QHB24645.1	6.22e-154	1	244	133	376
QEI32150.1	6.22e-154	1	244	133	376
QJU19354.1	2.53e-153	1	243	133	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.62e-60	2	245	143	379	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.95e-55	5	245	147	380	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.22e-54	4	241	127	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	2.94e-34	1	248	106	341	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000187_00342.