CAZyme Information: MGYG000000187_00414

Basic Information

• Species: Lachnospira sp003537285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp003537285
• CAZyme ID: MGYG000000187_00414
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000000187_4|CGC2	39413.88	8.706

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000187	2804290	Isolate	China	Asia

• Gene Location: Start: 55668; End: 56723 Strand: -

Full Sequence      

MFITIAVIAYNEENTIKNILDDISRQDYDHSLMEVVLVDSASTDGTKAVMQKFADENKMG
ARQIIVLDNPKKTLPCGWNVLLDNYTGEAVIRVDAHAHIPEDFVSKNVKVLEEGEMVVGG
VRPNIVDEETPWKDTLLLAESSMFGSSIAPYRNGGNGTEEKIYMKSLFHAAYRREVFEKI
GHYNEALARTEDNEIHYRMRKAGFKLRFCPDIISYQHTRSSLPKMLKQKYANGYWIGKTS
KVCPGCLSIYHFVPWAFVMAIIVTTVASVSCKLLAVKSIFSRIVYGLTGLMWGAYWLLAV
VMSIVAVIGAKKERNKTCFALPFLFFLLHISYGIGTVCGLAAKKPAKETRN

Enzyme Prediction     

No EC number prediction in MGYG000000187_00414.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	181	3e-24	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02525	Succinoglycan_BP_ExoA	1.42e-93	2	258	1	249	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
pfam00535	Glycos_transf_2	5.13e-19	4	177	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	2.28e-17	2	308	55	363	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd04192	GT_2_like_e	3.89e-17	7	229	2	223	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	4.47e-17	5	208	1	155	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR71118.1	5.87e-255	1	351	1	351
ASM68836.1	1.43e-134	1	340	1	321
CBL26245.1	2.74e-128	1	339	1	321
CEJ74666.1	1.11e-124	1	340	1	321
AHF07667.1	6.90e-114	1	340	1	322

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	4.11e-12	3	213	44	243	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	4.13e-12	3	213	45	244	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3VA59	1.01e-16	2	333	3	308	Dolichyl N-acetyl-alpha-D-glucosaminyl phosphate 3-beta-D-2,3-diacetamido-2,3-dideoxy-beta-D-glucuronosyltransferase OS=Methanococcus voltae OX=2188 GN=aglC PE=1 SV=1
P33691	4.93e-14	35	233	42	233	Succinoglycan biosynthesis protein ExoA OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000020	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
254	276
283	305
320	342