CAZyme Information: MGYG000000187_00503

Basic Information

• Species: Lachnospira sp003537285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp003537285
• CAZyme ID: MGYG000000187_00503
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		47116.47	4.2708

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000187	2804290	Isolate	China	Asia

• Gene Location: Start: 53364; End: 54623 Strand: -

Full Sequence      

MNVGYVHTFEVPENNIDKGRLKVSVVNEENVPIKGAAVRLSYTGNPDNIIGESGTDGDGI
SIFNDLRTPPIEYSMEPGNRQPFSEYDIAVSAPGFDNVNISGSDMFSGELSIQNVKMSAR
DNSQNNIVIPVNTLYGDYPPKIDEEEIKPMGQSGEIVLDRVVVPEIVVVHDGPPKDTEAD
NYYVTYKDYIKNVASSEIYSTWPRQTIEANVLAIMSFTLNRVYTEWYRNKFYDFTITSST
AYDQKWVNGRNVFESISQVVDDIFDNYISRPNVKQPILTQYCDGKRVTCPNRLSQWGSKY
LGDQNYSSIDILRYYYGQDVYINAAEQISGIPYSWPGTNLDIGSSGQKVRQLQEQLNLIG
EYYNSIPVLSTDGIYGEQTAAAVKEFQRIFNLPQSGITDFPTWFTVSEKYVALAGLAEL

Enzyme Prediction     

No EC number prediction in MGYG000000187_00503.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	5.92e-14	345	403	1	54	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	1.82e-09	302	406	3	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	2.67e-07	336	403	117	180	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	2.23e-05	177	316	104	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
pfam13620	CarboxypepD_reg	0.004	20	117	1	81	Carboxypeptidase regulatory-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VCV21206.1	8.57e-187	13	419	8	418
AWY98201.1	2.63e-186	17	419	15	420
QJU14725.1	1.75e-184	17	419	15	420
QQQ92685.1	1.75e-184	17	419	15	420
ASU27931.1	1.75e-184	17	419	15	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000187_00503.