CAZyme Information: MGYG000000187_00882

Basic Information

• Species: Lachnospira sp003537285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp003537285
• CAZyme ID: MGYG000000187_00882
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		26246.55	9.7246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000187	2804290	Isolate	China	Asia

• Gene Location: Start: 19759; End: 20454 Strand: +

Full Sequence      

MAKKKLSKKKRRIRLIRRIILLTILLAIAIGLLVFSPKIIKIIGLAQEAKSLVSKSTADT
FRESGTTVIYDTDGNELCTMRESKDMYYVEMDNIPDTLAQAFIVMEDKDFYSHKGIDFKA
IIRAIIANTENDEIVQGASTITQQLAKNIFLSQDVTWERKVKEMFVARDLEKKYSKKQIL
EFYLNNIYFSNGYYGVGAAAKGYFGKDVSELTLSEQAFIAAIPNNPTRYIP

Enzyme Prediction     

No EC number prediction in MGYG000000187_00882.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	74	230	2e-62	0.8757062146892656

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.80e-79	73	231	1	158	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	2.65e-72	64	231	53	222	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.75e-69	87	231	3	147	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	5.83e-67	66	231	48	212	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	4.46e-46	69	231	50	211	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72912.1	6.34e-115	1	231	1	231
BCN28959.1	5.12e-68	3	231	7	245
CUH93821.1	8.09e-68	13	231	18	238
BBF44496.1	2.28e-67	3	231	5	235
AQP39446.1	3.90e-65	25	231	37	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.05e-45	87	231	21	165	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	8.19e-45	87	231	21	165	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	5.31e-35	88	229	59	206	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	5.74e-35	88	229	23	170	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	5.89e-35	88	229	24	171	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	2.10e-44	69	231	58	221	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
O66874	4.41e-43	21	231	8	208	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
P38050	3.00e-39	69	231	51	212	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P70997	4.66e-38	67	231	55	219	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
Q68VU2	8.51e-38	67	231	49	215	Penicillin-binding protein 1A OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=mrcA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.985067	0.002354	0.000826	0.000014	0.000009	0.011742

TMHMM  Annotations     

start	end
13	35