CAZyme Information: MGYG000000187_01637

Basic Information

• Species: Lachnospira sp003537285
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Lachnospira; Lachnospira sp003537285
• CAZyme ID: MGYG000000187_01637
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
313	MGYG000000187_22|CGC1	35093.1	4.7619

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000187	2804290	Isolate	China	Asia

• Gene Location: Start: 31195; End: 32136 Strand: +

Full Sequence      

MITVAKDNSGDFNSIQQAVDSIPAGTPETIYIKKGIYKERVEVRKNNISFVGESTDDTII
TESYYARMIMPDGSKRGTFRSYTFFVYADNFTASNLTFENAAGFGDEFGQAIAVYAEGDN
ITFRNCKILGHQDTLFTGPLPMKEKQPGGFTGPTIDGIRRVVHQLYEDCYIAGEIDFIFG
SATAYFKNCTLFALNRNQEINAFYTAPSTYEGQAFGYVFESCTFTGNCPPKSVALSRPWR
IHAKTVLLNCSYSDQIIDEGFTDWNKPESHETVYYAEYNGHGEGFKPEKRAAYVHQLNES
EAALYTLENVMNS

Enzyme Prediction     

No EC number prediction in MGYG000000187_01637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	2	312	9.9e-91	0.9895833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	4.91e-73	1	310	83	401	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	1.56e-60	2	306	2	290	Pectinesterase.
PLN02773	PLN02773	7.65e-54	1	303	6	288	pectinesterase
PLN02432	PLN02432	4.65e-51	1	303	12	278	putative pectinesterase
PLN02990	PLN02990	2.93e-49	2	306	261	549	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72174.1	1.64e-235	1	313	1	313
ADZ82949.1	6.42e-109	4	312	3	313
QEH68466.1	2.59e-108	4	312	3	313
SET76962.1	3.32e-106	1	312	1	314
ABX41678.1	7.22e-101	2	311	5	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NSP_A	7.52e-34	1	311	7	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	4.29e-32	11	254	43	282	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1GQ8_A	7.13e-31	2	284	9	272	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	2.58e-30	4	290	7	274	ChainA, Pectinesterase 1 [Solanum lycopersicum]
1QJV_A	2.93e-29	1	311	7	334	ChainA, PECTIN METHYLESTERASE [Dickeya chrysanthemi],1QJV_B Chain B, PECTIN METHYLESTERASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	4.82e-40	1	302	6	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	1.25e-39	4	306	260	546	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FJ21	4.49e-38	2	306	260	548	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q8RXK7	1.20e-37	1	311	258	554	Probable pectinesterase/pectinesterase inhibitor 41 OS=Arabidopsis thaliana OX=3702 GN=PME41 PE=2 SV=2
Q43043	4.91e-37	3	290	60	329	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999265	0.000696	0.000056	0.000003	0.000001	0.000026

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000187_01637.