CAZyme Information: MGYG000000190_00547

Basic Information

• Species: CAG-127 sp900319515
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900319515
• CAZyme ID: MGYG000000190_00547
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
199		22336.16	6.4596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000190	2845715	Isolate	China	Asia

• Gene Location: Start: 597822; End: 598421 Strand: -

Full Sequence      

MVSGYRNKGYNFTITSSTAYDHKWIYGKTIYENISQIADRLYNRYLARPNVKQPILTQYC
DGKRVSCPNWMTQWGSKALGDDGFSAIDIIHYYYGSDMYVNEAEIVSGIPSSYPGYDLTI
GSSGEPVITIQEQLNRIAQNYPAIPTVTVDGIFGSATTESVRAFQSIFNLPVSGIVDFPT
WYKISQIYVGVSKIGENIR

Enzyme Prediction     

No EC number prediction in MGYG000000190_00547.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	3.05e-14	123	184	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	2.94e-12	113	186	116	185	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.27e-09	118	184	39	102	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT53249.1	1.78e-139	5	199	226	420
QCU03784.1	9.01e-96	5	196	229	422
QRV22093.1	1.00e-95	5	196	223	414
QJU14725.1	6.65e-95	5	196	228	419
QQQ92685.1	6.65e-95	5	196	228	419

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000190_00547.