CAZyme Information: MGYG000000190_01954

Basic Information

• Species: CAG-127 sp900319515
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900319515
• CAZyme ID: MGYG000000190_01954
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355		41660.54	6.5821

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000190	2845715	Isolate	China	Asia

• Gene Location: Start: 194990; End: 196057 Strand: -

Full Sequence      

MGRLNGLNLEQLISLVKKHKVACFGLGIQGRRMADFFSNWNIQEQLVAYIDNNKAKIGDF
YSHDGYKYPVYSFDEAHQALDENVVILITCLDYNEIYKQLESDVIRKWDYIAFAEVSDNE
LISSNYHEVIKETINPVIPKKIHYVWLGGKKTLLINENIKQWRKICPDYEFYEWNEKNYD
ISSNLYMKQAYERKKWGFVSDYMRLDIIYKYGGIYLDTDIEMIKKPDQLLYQECFGCVDS
SMTMNLGSGFGAIPKTKIIRELRDYYDGITFIKEDGSEDNTSCNSHSYHVLKKWGVMIND
QLQNVGGMNIYPMIFQGANQHTKKIYKTDKTFWIHYGNMSWFKRKSMEGTDEVCG

Enzyme Prediction     

No EC number prediction in MGYG000000190_01954.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	156	231	5.7e-22	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04488	Gly_transf_sug	1.72e-15	156	235	5	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
COG3774	OCH1	1.84e-13	136	233	80	181	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam12919	TcdA_TcdB	1.44e-05	140	178	1	39	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam05704	Caps_synth	0.002	131	235	39	150	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.006	72	219	54	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92952.1	2.98e-68	17	345	16	346
BCJ92955.1	1.01e-66	3	343	2	347
BBF44126.1	9.64e-57	21	347	20	356
ACR71293.1	2.34e-56	17	353	18	357
BCJ92956.1	6.91e-56	13	348	12	350

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000190_01954.