CAZyme Information: MGYG000000190_02144

Basic Information

• Species: CAG-127 sp900319515
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-127; CAG-127 sp900319515
• CAZyme ID: MGYG000000190_02144
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		35509.18	8.0425

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000190	2845715	Isolate	China	Asia

• Gene Location: Start: 89353; End: 90261 Strand: +

Full Sequence      

MADIIFAFVVLHYNEPKVTEKCVKAIRENTKKHSSEIVIVDNCSPDGSGVYLEKKYKDQP
HITVLKAEKNLGFARGNNIGYTYAKQTLHADYICVMNNDVLLLQPDFIERIVQEYETSKC
GIVGPHITLLNGYTNYMYLKIHTREYFEHELQMSKQMYRYYTSRLYPVRNIINRTLDKLL
PALKFQKQPVKETLDDKIQMVIASKQRHKNIVLHGCCLILTPLYIGKFDTAFDDRTFMFR
EEELLYLRCRKHEIETVYEPSIDILHLEDMSTNATFKKDCKREAFKNKCQIDSLQILLEE
LR

Enzyme Prediction     

No EC number prediction in MGYG000000190_02144.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	9	153	4.7e-21	0.8294117647058824

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	8.19e-25	9	128	2	113	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	3.64e-20	9	147	3	135	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1216	GT2	2.93e-18	1	273	2	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd00761	Glyco_tranf_GTA_type	3.72e-16	9	161	2	147	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd04185	GT_2_like_b	5.22e-14	9	132	2	121	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM00307.1	3.13e-223	1	302	1	302
QWT54172.1	3.99e-157	1	302	1	301
VEF84846.1	5.06e-54	8	301	4	286
QDA38073.1	5.06e-54	8	301	4	286
QCQ03259.1	9.00e-54	6	301	3	284

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000190_02144.