CAZyme Information: MGYG000000191_00491

Basic Information

• Species: Weizmannia coagulans
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; Bacillaceae_C; Weizmannia; Weizmannia coagulans
• CAZyme ID: MGYG000000191_00491
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46656.25	5.2541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000191	2910060	Isolate	China	Asia

• Gene Location: Start: 176813; End: 178072 Strand: +

Full Sequence      

MKIHIVQKGDTLWKIAKKYGADFDELKKLNAQLSNPEMIMPGMKIKVPTTGGMVKKETHT
GHAGYTGHAGAKEMPLVTHPYEQMPEVKMPVAKEIPVQKELPKAAGPKEMPVKEKVVEKK
ETIYKPVMPQPVIPEIDIHNYYVTNMAEIETHTAAPPPKHHESESSESMHYTMPVKEECP
EMYVPYNPCPPVMPVYDCGCGGEDMHAGFFPHPFSMSYPQVPYPMPYPMAYPQMPVMSAP
AGFMPQQQPAWQEGQQVMPGYEWEEESSSSSPYPYGPNMQAGVSAQHPAAVPQWGAQQAP
LYGAASESPAYMPQYMPPQTMPQYAPYPPHQPQPCGCQKQPYAGMQESYGMAAQPYGMQE
PFGGMPQPPYGMPQPPYGMPQPPYGVQEPYGMQAPFGYDRGEKTDQPQETRDPSGEEEK

Enzyme Prediction     

No EC number prediction in MGYG000000191_00491.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02899	spore_safA	3.36e-19	6	49	1	44	spore coat assembly protein SafA. SafA (YrbB) (SafA) of Bacillus subtilis is a protein found at the interface of the spore cortex and spore coat, and is dependent on SpoVID for its localization. This model is based on the N-terminal LysM (lysin motif) domain (see pfamAM model pfam01476) of SafA and, from several other spore-forming species, the protein with the most similar N-terminal region. However, this set of proteins differs greatly in C-terminal of the LysM domaim; blocks of 12-residue and 13-residue repeats are found in the Bacillus cereus group, tandem LysM domains in Thermoanaerobacter tengcongensis MB4, etc. in which one of which is found in most examples of endospore-forming bacteria. [Cellular processes, Sporulation and germination]
cd00118	LysM	4.86e-14	2	47	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	2.13e-13	3	47	1	44	Lysin motif.
pfam01476	LysM	1.23e-12	4	48	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1388	LysM	1.53e-09	2	53	67	116	LysM repeat [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE32972.1	7.07e-226	1	419	1	419
AJH78103.1	7.07e-226	1	419	1	419
QPG52369.1	1.57e-225	1	419	1	412
AEH53902.1	9.18e-225	1	419	11	422
QWU05784.1	5.38e-203	1	419	1	423

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32062	2.76e-21	1	75	1	80	SpoIVD-associated factor A OS=Bacillus subtilis (strain 168) OX=224308 GN=safA PE=1 SV=1
Q6B4J5	1.28e-19	1	63	1	63	Spore coat assembly protein ExsA OS=Bacillus cereus OX=1396 GN=exsA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000191_00491.