CAZyme Information: MGYG000000191_02279

Basic Information

• Species: Weizmannia coagulans
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; Bacillaceae_C; Weizmannia; Weizmannia coagulans
• CAZyme ID: MGYG000000191_02279
• CAZy Family: CE4
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000000191_29|CGC1	31168.52	6.6911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000191	2910060	Isolate	China	Asia

• Gene Location: Start: 1605; End: 2420 Strand: +

Full Sequence      

MKRWISLLLIALLLLNGQLVEAKGSDESKQCLALNYHRLIKDDLFTNVISLLTSNKELNF
YSIKDSEFEAQMDWLIAHDATFVTEETLIQDKERGKFPERCVWVNFDDMDQSVLKLAHPI
LKERGIPATGFVITGHVGDDSFHNLKLIDLKGLKEMEASGIWQFNSHTHDLHNLKRSTSD
LVKHSSKADADIDRSVKYLDQHFNKKATSLAYPYGQYDDAVIDTLKHSPIRHAYVLKDTP
IHVDDDNYTLPRILVTRDSFEKVVKNWKGFK

Enzyme Prediction     

No EC number prediction in MGYG000000191_02279.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	95	228	6.9e-20	0.8923076923076924

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03933	PIA_icaB	9.00e-146	29	270	1	244	intercellular adhesin biosynthesis polysaccharide N-deacetylase. A common motif in bacterial biosynthesis of polysaccharide for export is modification that follows polymerization. This model describes a subfamily of polysaccharide N-deacetylases that acts on poly-beta-1,6-N-acetyl-D-glyscosamine as produced by Staphylococcus epidermidis and S. aureus. The end product in these species is designated polysaccharide intercellular adhesin (PIA), and this gene designated icaB (intercellular adhesion protein B). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides, Cellular processes, Pathogenesis]
cd10965	CE4_IcaB_5s	7.61e-53	98	267	1	171	Putative catalytic polysaccharide deacetylase domain of bacterial intercellular adhesion protein IcaB and similar proteins. The family is represented by the surface-attached protein intercellular adhesion protein IcaB (Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase, EC 3.5.1.-), encoded by Staphylococcus epidermidis icaB gene from the icaABC gene cluster that is involved in the synthesis of polysaccharide intercellular adhesin (PIA), which is located mainly on the cell surface. IcaB is a secreted, cell wall-associated protein that plays a crucial role in exopolysaccharide modification in bacterial biofilm formation. It catalyzes the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. IcaB shows high homology to the N-terminal NodB homology domain of Escherichia coli PgaB. At this point, they are classified in the same family.
cd10918	CE4_NodB_like_5s_6s	2.13e-33	102	258	2	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10966	CE4_yadE_5s	4.91e-29	98	262	1	163	Putative catalytic polysaccharide deacetylase domain of uncharacterized protein yadE and similar proteins. This family contains an uncharacterized protein yadE from Escherichia coli and its bacterial homologs. Although its molecular function remains unknown, yadE shows high sequence similarity with the catalytic NodB homology domain of outer membrane lipoprotein PgaB and the surface-attached protein intercellular adhesion protein IcaB. Both PgaB and IcaB are essential in bacterial biofilm formation.
396211	pfam01522	1.81e-26	94	226	1	117	Polysacc_deac_1 Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJH80045.1	3.87e-197	1	271	1	271
QJE32688.1	3.87e-197	1	271	1	271
QYA36114.1	4.16e-192	1	270	1	270
QQB05557.1	1.69e-191	1	270	1	270
AID41542.1	1.25e-88	21	271	32	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WCJ_A	5.35e-19	61	263	51	256	Structureof IcaB from Ammonifex degensii [Ammonifex degensii KC4]
4U10_A	6.33e-14	34	267	7	262	Probingthe structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans],4U10_B Probing the structure and mechanism of de-N-acetylase from aggregatibacter actinomycetemcomitans [Aggregatibacter actinomycetemcomitans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5HKP8	9.09e-81	15	270	26	285	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaB PE=3 SV=1
Q6TYB1	9.09e-81	15	270	26	285	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus epidermidis OX=1282 GN=icaB PE=1 SV=2
Q6G606	2.46e-78	7	270	14	286	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaB PE=3 SV=1
Q7A349	2.46e-78	7	270	14	286	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaB PE=3 SV=1
Q8NUI6	2.46e-78	7	270	14	286	Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000183	0.999243	0.000156	0.000150	0.000140	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000191_02279.