CAZyme Information: MGYG000000191_02372

Basic Information

• Species: Weizmannia coagulans
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; Bacillaceae_C; Weizmannia; Weizmannia coagulans
• CAZyme ID: MGYG000000191_02372
• CAZy Family: CBM50
• CAZyme Description: Cell wall-binding protein YocH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
178		19043.47	11.2277

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000191	2910060	Isolate	China	Asia

• Gene Location: Start: 30263; End: 30799 Strand: +

Full Sequence      

MKKTLVSLLTVCMLSIGTGHAFAATTTYTVKPGDSLYKIAGKYHVTVAQLKSWNHLRSNV
IRVKQRLKIQTKTPAKKVSSSSSSYRTMTVKATAYTAGSGGGITATGINLKRHPSAKVIA
VDPKVIRLGSKVYVPGYGTAVAGDTGGAIKGKKIDVFISSKKKALQWGRKTVTIKVYK

Enzyme Prediction     

No EC number prediction in MGYG000000191_02372.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3584	3D	1.90e-42	85	176	16	109	3D (Asp-Asp-Asp) domain [Function unknown].
cd14667	3D_containing_proteins	3.14e-32	90	177	1	90	Non-mltA associated 3D domain containing proteins, named for 3 conserved aspartate residues. This family contains the 3D domain, named for its 3 conserved aspartates, including similar uncharacterized proteins. These proteins contain the critical active site aspartate of mltA-like lytic transglycosylases where the 3D domain forms a larger domain with the N-terminal region. This domain is also found in conjunction with numerous other domains such as the Escherichia coli MltA, a membrane-bound lytic transglycosylase comprised of 2 domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, corresponding to the 3D domain and Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial LTs, which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond.
cd14486	3D_domain	1.75e-20	90	176	1	103	3D domain, named for 3 conserved aspartate residues, is found in mltA-like lytic transglycosylases and numerous other contexts. This family contains the 3D domain, named for its 3 conserved aspartates. It is found in conjunction with numerous other domains such as MltA (membrane-bound lytic murein transglycosylase A). These aspartates are critical active site residues of mltA-like lytic transglycosylases. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. MltA has 2 domains, separated by a large groove, where the peptidoglycan strand binds. The C-terminus has a double-psi beta barrel fold within the 3D domain, which forms the larger A domain along with the N-terminal region of Mlts, but is also found in various other domain architectures. Peptigoglycan (also known as murein) chains, the primary structural component of bacterial cells walls, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc); lytic transglycosylases (LTs) cleave this beta-1-4 bond. Typically, LTs are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, membrane-bound lytic murein transglycosylase E (MltE) is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane- bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and family 4 of bacteriophage origin. While most LTs are related members of the lysozyme-like lytic transglycosylase family, MltA represents a distinct fold and sequence conservation.
pfam06725	3D	1.11e-15	117	177	1	69	3D domain. This short presumed domain contains three conserved aspartate residues, hence the name 3D. It has been shown to be part of the catalytic double psi beta barrel domain of MltA.
pfam01476	LysM	9.84e-15	28	69	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJE33712.1	2.69e-117	1	178	1	178
AJH79377.1	2.69e-117	1	178	1	178
AVD55745.1	2.69e-117	1	178	1	178
QYF71487.1	2.47e-113	1	178	1	178
ATW83601.1	2.47e-113	1	178	1	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WLI_A	7.10e-12	85	178	11	114	StationaryPhase Survival Protein YuiC from B.subtilis [Bacillus subtilis subsp. subtilis str. 168]
4WLK_A	1.04e-11	85	178	32	135	StationaryPhase Survival Protein YuiC from B.subtilis complexed with reaction product [Bacillus subtilis subsp. subtilis str. 168],4WLK_B Stationary Phase Survival Protein YuiC from B.subtilis complexed with reaction product [Bacillus subtilis subsp. subtilis str. 168]
4WJT_A	1.06e-11	85	178	32	135	StationaryPhase Survival Protein YuiC from B.subtilis complexed with NAG [Bacillus subtilis subsp. subtilis str. 168],4WJT_B Stationary Phase Survival Protein YuiC from B.subtilis complexed with NAG [Bacillus subtilis subsp. subtilis str. 168]
2MKX_A	3.26e-07	26	67	5	46	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34669	3.59e-35	25	176	75	285	Cell wall-binding protein YocH OS=Bacillus subtilis (strain 168) OX=224308 GN=yocH PE=1 SV=1
P37546	5.38e-28	80	176	307	405	Putative cell wall shaping protein YabE OS=Bacillus subtilis (strain 168) OX=224308 GN=yabE PE=2 SV=2
O32108	1.24e-10	85	178	83	186	Uncharacterized protein YuiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yuiC PE=1 SV=1
Q49UX4	2.80e-08	2	73	3	74	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
O07532	1.53e-07	23	72	237	286	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000288	0.998973	0.000181	0.000188	0.000179	0.000161

TMHMM  Annotations     

start	end
5	27