CAZyme Information: MGYG000000191_02386

Basic Information

• Species: Weizmannia coagulans
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; Bacillaceae_C; Weizmannia; Weizmannia coagulans
• CAZyme ID: MGYG000000191_02386
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000000191_32|CGC1	35441.95	9.628

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000191	2910060	Isolate	China	Asia

• Gene Location: Start: 12721; End: 13635 Strand: -

Full Sequence      

MDKVAIIIINYNNYSDTIECLTSIEKLEYDQYRVYLVDNGSTNSSYNILREFLVSLNYEV
DLIKNDNSGFAGGNNIAINKAIADGYKYFWLLNNDTVVNKFSLKSLMKVIKSDKKCGIVG
SKIYYYGTDKLWFAGGKINKFFGVPKHVGIKEKDSKKYNSIKEMDYITGCSLLLKYEVIQ
TIGYMDESYFLYYEETDWNIRARKYGWRVVYVPESVVHHKISSSSGGEKNISPSFYYYDI
RNRYIMNRRLNPTMIIPNFVYLHYDILKKLLKIFVKKETRKKDKVINIFKGYLHAILNIS
GPLS

Enzyme Prediction     

No EC number prediction in MGYG000000191_02386.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	6	171	1.7e-19	0.9235294117647059

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1216	GT2	1.10e-64	1	283	2	289	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04186	GT_2_like_c	3.31e-53	6	220	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02526	GT2_RfbF_like	1.28e-25	7	243	2	233	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04185	GT_2_like_b	3.29e-25	7	246	2	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.74e-15	6	175	2	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBW97701.1	2.27e-108	4	293	9	303
ASS98126.1	1.06e-106	4	299	9	305
AAQ23683.1	1.33e-99	3	296	8	306
ASS68718.2	9.37e-97	2	291	3	294
QKS47429.1	9.64e-94	2	301	3	307

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4GU63	2.18e-10	1	301	17	302	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P37782	8.57e-06	7	249	8	241	dTDP-rhamnosyl transferase RfbF OS=Shigella flexneri OX=623 GN=rfbF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000040	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000191_02386.