CAZyme Information: MGYG000000191_02757

Basic Information

• Species: Weizmannia coagulans
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_B; Bacillaceae_C; Weizmannia; Weizmannia coagulans
• CAZyme ID: MGYG000000191_02757
• CAZy Family: GH18
• CAZyme Description: Spore germination protein YaaH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263		29656.27	10.5999

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000191	2910060	Isolate	China	Asia

• Gene Location: Start: 967; End: 1758 Strand: +

Full Sequence      

MLSKEMTRSQILRKDTASRLVIGQAIVIPITGRFYWVRPGDSLYSIAQQAGISYQELARI
NGISVHQQLRPGLRLYLPPSPKKRAEFNAYVEPFGNTVSASLETSARKAAPYLTYLAPFA
FRVNRDGTLVAPPLGNLRAVADAQNAILMMVICNQENGQFSDELGRILLNDETVQNRFLN
EIVQTASRLGFRDIHFDFEYLRPQDKEAYNRFLRKAKTRFSRESWLMFTALAPKTSATQA
GRCAGMRHTITGRMAKLPILLSL

Enzyme Prediction     

EC	3.2.1.-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3858	YaaH	1.56e-60	16	242	33	259	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd02874	GH18_CFLE_spore_hydrolase	4.54e-47	85	242	2	155	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
cd00118	LysM	1.10e-12	33	77	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	9.03e-10	35	78	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG0739	NlpD	8.25e-08	35	143	4	110	Murein DD-endopeptidase MepM and murein hydrolase activator NlpD, contain LysM domain [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPG53645.1	6.56e-167	1	242	1	242
AJH80170.1	1.81e-164	6	242	1	237
AEH52136.1	1.02e-153	19	242	37	260
AVD54751.1	2.05e-153	19	242	37	260
AWP35599.1	2.05e-153	19	242	37	260

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3K_A	2.41e-52	18	242	39	264	ChainA, Spore germination protein YaaH [Priestia megaterium QM B1551]
4S3J_A	3.70e-44	15	242	35	262	Crystalstructure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_B Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876],4S3J_C Crystal structure of the Bacillus cereus spore cortex-lytic enzyme SleL [Bacillus cereus ATCC 10876]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37531	1.81e-72	20	242	38	260	Cortical fragment-lytic enzyme OS=Bacillus subtilis (strain 168) OX=224308 GN=sleL PE=1 SV=2
P0DPJ9	1.23e-45	15	242	34	261	Cortical fragment-lytic enzyme OS=Bacillus anthracis OX=1392 GN=sleL PE=2 SV=1
Q9K3E4	2.55e-44	15	242	34	261	Cortical fragment-lytic enzyme OS=Bacillus cereus OX=1396 GN=sleL PE=1 SV=1
O05495	3.04e-12	18	236	35	249	Putative sporulation-specific glycosylase YdhD OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	37