CAZyme Information: MGYG000000192_01750

Basic Information

• Species: Holdemania filiformis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemania; Holdemania filiformis
• CAZyme ID: MGYG000000192_01750
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000000192_9|CGC1	57080.13	5.0993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000192	3744496	Isolate	China	Asia

• Gene Location: Start: 93091; End: 94563 Strand: +

Full Sequence      

MRKFPEGFLWGGATAANQIEGGWREGGKGWSVSDAARAHFDADVKDYNRHNQITTRDIEE
ALAHPEDEVNYPKRHGSDFYHHYKEDIALMAEMGFKVYRMSIAWSRIYPNGDDEQPNEAG
LQFYDEVFDELKKYNIEPLVTMSHYEPPLNLVLNYDGWYSREVIGFFEKYVRTICERYKH
KVKYWLTFNEVDSIIRHPFTTGGLIEDRFPGKNFEEVCYQAMHHQFVASALATKICHEII
PDSQVGCMITKLTYYPYSCKPEDVLETQKRMRSIYAYSDTQVFGEYPSTLLSYYKNHNIH
IVKQPGDDEVMKQYPVDFVSFSYYMSSCVAADETGLDVTPGNTILAVKNPHLETSEWGWQ
IDPIGLRISLVDLYDRYRKPLFVVENGLGAKDVLSADGKVHDPYRIDYLRKHFKCMLDAI
EEDGVELMGYTSWACIDLISESTKQISKRYGYIYVDLDDQGNGTYNRIRKDSFYWYQKVI
QNNSLDFEEQ

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	484	1.9e-141	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	3	483	5	473	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	483	1	453	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	4	488	6	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	1	483	1	472	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	1	488	1	474	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT46149.1	0.0	1	488	1	487
AYD20142.1	0.0	1	488	1	488
AXB63304.1	0.0	1	488	1	488
CAJ67210.1	0.0	1	488	1	488
AXU55898.1	0.0	1	488	1	488

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	6.01e-185	2	483	6	465	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	3.20e-169	1	483	17	481	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	2.42e-164	5	483	9	475	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.52e-160	1	486	4	479	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.31e-160	1	486	4	479	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	7.53e-188	2	483	6	465	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	6.89e-180	1	488	1	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	2.34e-175	3	488	6	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	7.98e-174	1	489	1	464	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P11988	7.39e-166	1	489	1	464	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999993	0.000067	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000192_01750.