CAZyme Information: MGYG000000192_03090

Basic Information

• Species: Holdemania filiformis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Holdemania; Holdemania filiformis
• CAZyme ID: MGYG000000192_03090
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MGYG000000192_26|CGC1	55450.51	4.827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000192	3744496	Isolate	China	Asia

• Gene Location: Start: 30027; End: 31469 Strand: +

Full Sequence      

MKHGFPDNFLWGGAIAANQAEGAWNEGGKGLSVPDVDWHNPHLVRGGKRDADSEMTSTRL
NELLAISEDWQFPKRSGIDFYHTYKDDLALMKQLGLKAFRTSINWARIYPNGDDEQPNEE
GLQFYDELIDTIVASGMEPIITLFHYELPLKLVTEYGGWRDKRLIEFYARFARTCFERYQ
GKVKYWILINQINLIYVESFNSLGILCDQVDNLEEAKYQAIHNQFVACSLATKLGREIDP
EFKLGMMISDHNCYPETASPEDVFSTLQKNQMSQFFYGDVRIRGQYPGYALRYFEDHQLN
IEMTEEELDLIHRYTADYMAFSYYYSRMNSAVHNTADLNDISRNPLLPASIWGWCVDPLG
LRNSLNVYYDRYQLPLMIAENGLGALDELKAGTVEDDYRIDYLRAHLKAIKEAIRDGVDV
FAYCAWGPIDIVSCTTNEMSKRYGFVYVDLNDDGTGSRKRFKKKSFDWYKRVIETNGADL

Enzyme Prediction     

No EC number prediction in MGYG000000192_03090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	477	2.2e-138	0.9953379953379954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	4	480	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	5	480	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	0.0	5	479	4	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	2.26e-180	2	480	3	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	3.76e-159	5	480	6	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQL13776.1	9.71e-200	1	480	6	480
BCT44163.1	4.08e-198	4	480	7	477
AKF94736.1	8.51e-198	5	480	8	478
ALP03197.1	3.45e-197	5	480	4	475
AXU73116.1	4.89e-197	5	480	4	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IPL_A	4.81e-171	5	480	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
6WGD_A	7.92e-168	5	480	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	7.54e-153	6	480	9	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
3QOM_A	8.06e-153	5	480	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	1.10e-152	6	480	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	1.63e-174	5	480	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	8.94e-163	5	480	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	4.21e-157	6	480	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q48409	1.76e-152	5	480	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46829	4.13e-152	6	480	9	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000009	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000192_03090.