CAZyme Information: MGYG000000193_00672

Basic Information

• Species: KLE1615 sp900066985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615; KLE1615 sp900066985
• CAZyme ID: MGYG000000193_00672
• CAZy Family: GH28
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
970	MGYG000000193_5|CGC2	108267.65	5.025

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000193	4116467	Isolate	China	Asia

• Gene Location: Start: 64894; End: 67806 Strand: +

Full Sequence      

METIKEATGAAIRPHDLSYETILYASDFGAAPKKSAVENTQAINQAILAASKQGGATVVI
AKGEYRTYTIELASHVHLHFEEGAVIRAARTDIKHSYVNQDGEGGNYLEPEINRFAGLQD
HGHSYFANSLFYGADLCDIMISGDGLIDGSSWNEEEKCREYVLLGGDPSEPAFRNERGHN
GEWFGNKAIALVRCKNVVLTDFSLVIGGHFAIIAEGVENMYVDGILIDTNRDAFDVDCCK
DVTVRNSVFNSLTDDGLVMKSSYGAGIFMPLENVLIEDCKVSGYDAGSVYAKTYTNEKLV
AEDRCGPTGRVKLGTESSCGYHQVTVRRVDFEHSRGFALEAVDGSDLTDIIFEDSHMKYI
SSSPIFIRVGDRCRFPVTGMQMSEEIQAKAPNIRLDNRGFVIPDNEHYPVIPAVRYTPSY
NKTKLVSVDGRSFFTVVDEENPVTLNQANLVKEDGVTYGKKYVAGEGYVADRTKPLDAPE
AASRANGCSRPLARVKNIRIARVSAESVDPRYPILLAGLDGSSIENVQLEDIKVTYRGGL
TMEHATEQRQLNTNWEYTQYQTKPSIQSLPWLVNTFFLKNEGLLPRVDWDEKTKSWKDDP
YNVPELPTSYPEPSIFGILPAYGFYARHVKGLEVKGLSIGFEKEDTRHAIVLDDVEDASF
EDLSLQTAKETQEVAFVTSMYKRPANLEYVPDQPYHMTTITNVTLPENISVKLATVEAPA
PGTPRDSFYSCPTLPIPENGYRYQKETDVYPLPLTVFPPFENRTTGKTRNPAEETSRKEV
PGMIYNEGLAQREYTVYRDHGKHVSVTMKKMTKEQVGEIAAVERACFLPAEAASEKDFEE
RFSSPAFVCYGAYNEEGELIGFIDGASYDKPELPDELYHDTTKLVENGPWQTVFGVNVIA
RYRRMGVAGQMVRHYVEESRKRGQDGVVLTCKDHLRPLYEKAGFIWQGVSASTHGGVKWN
DMLLRFRKGE

Enzyme Prediction     

No EC number prediction in MGYG000000193_00672.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	51	369	1e-36	0.7476923076923077

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	3.42e-38	5	392	65	429	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00583	Acetyltransf_1	1.65e-07	824	944	10	116	Acetyltransferase (GNAT) family. This family contains proteins with N-acetyltransferase functions such as Elp3-related proteins.
COG0456	RimI	5.29e-05	819	948	27	153	Ribosomal protein S18 acetylase RimI and related acetyltransferases [Translation, ribosomal structure and biogenesis].
cd04301	NAT_SF	8.13e-04	849	930	1	65	N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate. NAT (N-Acyltransferase) is a large superfamily of enzymes that mostly catalyze the transfer of an acyl group to a substrate and are implicated in a variety of functions, ranging from bacterial antibiotic resistance to circadian rhythms in mammals. Members include GCN5-related N-Acetyltransferases (GNAT) such as Aminoglycoside N-acetyltransferases, Histone N-acetyltransferase (HAT) enzymes, and Serotonin N-acetyltransferase, which catalyze the transfer of an acetyl group to a substrate. The kinetic mechanism of most GNATs involves the ordered formation of a ternary complex: the reaction begins with Acetyl Coenzyme A (AcCoA) binding, followed by binding of substrate, then direct transfer of the acetyl group from AcCoA to the substrate, followed by product and subsequent CoA release. Other family members include Arginine/ornithine N-succinyltransferase, Myristoyl-CoA: protein N-myristoyltransferase, and Acyl-homoserinelactone synthase which have a similar catalytic mechanism but differ in types of acyl groups transferred. Leucyl/phenylalanyl-tRNA-protein transferase and FemXAB nonribosomal peptidyltransferases which catalyze similar peptidyltransferase reactions are also included.
pfam13508	Acetyltransf_7	0.001	845	944	1	81	Acetyltransferase (GNAT) domain. This domain catalyzes N-acetyltransferase reactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93914.1	1.09e-312	1	842	1	865
CBL02329.1	9.06e-276	4	760	45	801
AXB28928.1	1.66e-275	4	760	63	819
AHG93184.1	2.85e-96	39	655	50	492
QOY86475.1	3.89e-94	27	655	28	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	1.19e-10	27	278	32	287	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
4MXN_A	2.33e-08	39	250	37	215	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000193_00672.