CAZyme Information: MGYG000000193_02346

Basic Information

• Species: KLE1615 sp900066985
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; KLE1615; KLE1615 sp900066985
• CAZyme ID: MGYG000000193_02346
• CAZy Family: GH31
• CAZyme Description: Alpha-xylosidase BoGH31A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		41080.63	4.5296

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000193	4116467	Isolate	China	Asia

• Gene Location: Start: 30210; End: 31286 Strand: -

Full Sequence      

MVSIWPTVDRASVNYEEMKERDLLIRTDRGLNVTMECFGMECFIDPTNPETREFVWQKAM
ENYRTLGVDLFWLDEAEPEYTVQDFDIYRYYDGPANECANEYPARYSQTFFDGMKKEGIE
NPLNLVRCAWAGSQRYGSLVWSGDVPSTFTYLRYQLTAGLNMGLAGIAWWTADIGGFHGG
NVHDPAFQELLMRWFQFGAFCPVMRLHGDRDPHYKPLGSTGGGMVASGADNEIWSYTPEI
QDMMSYYILLRESMKGYMTTVMKEAHEKGTPVMKPLFYDYPADKTCWEIADEFLFGHDLL
VAPVLYAGERTRTLYLPEGRWCEYETGKVYDGGCTITVDAPINRVPLFVKEGKTVFVK

Enzyme Prediction     

No EC number prediction in MGYG000000193_02346.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	1	354	7.5e-107	0.7611241217798594

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06591	GH31_xylosidase_XylS	5.07e-112	1	251	83	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
COG1501	YicI	5.09e-110	1	352	338	667	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	1.50e-108	1	352	100	439	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	1.37e-56	15	353	97	424	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PRK10426	PRK10426	6.25e-55	15	352	300	620	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUU48543.1	4.72e-163	1	351	338	689
AQR93685.1	1.41e-162	1	351	319	670
AGF54726.1	2.00e-162	1	351	319	670
AQS05637.1	1.14e-161	1	351	317	668
AJG99137.1	1.14e-161	1	351	317	668

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KMP_A	7.73e-56	1	355	510	865	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
2XVG_A	1.98e-52	1	355	507	874	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
5JOU_A	2.43e-50	1	352	479	841	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
6DRU_A	1.56e-49	1	348	321	704	Xylosidasefrom Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
6JR6_A	6.74e-49	1	355	338	688	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01336	2.68e-88	1	212	316	527	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
Q9P999	3.43e-55	2	352	295	619	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
A7LXT0	1.33e-49	1	352	478	840	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
A2QTU5	1.00e-48	1	348	339	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
Q9F234	2.77e-48	39	355	373	674	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000193_02346.