CAZyme Information: MGYG000000195_00250

Basic Information

• Species: Faecalibacterium prausnitzii_E
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_E
• CAZyme ID: MGYG000000195_00250
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
812		92020.31	5.0699

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000195	3389403	Isolate	China	Asia

• Gene Location: Start: 271006; End: 273444 Strand: +

Full Sequence      

MQLEKEKETREAAERCRLLAQRIAEELAPEAAAVLAADEESGALLEKALRRAGIRTNPWT
AAATAQPELLVVEDPVWVELPAQLAEQVLLVCTDATALSAWAEKLAERGYYRDLQWRSRG
RAQQAALFCTVQPSAMGMVRGYEEELDILRDRMVRAERTCGEEAALIERLRSDLSLSRSH
EKQLEQTLNEVTGSTFWKMTWPARYAVSKSRQLWHTFPLFVFLHELRTEGVSGMLEKARA
RRVYAALFPGMTMRADRFAPVELLVRQANDQPAGPKISIVVPLYNTPLNFLEELLDSVVN
QTYRNWELCCVDAGQDPAVGQKVQARAASDPRIRYQKLEKNELIPGNTNHGFEMATGAYI
ALLDHDDILHPCALWYAAKAIAEQKADFVYTDEATFEGEVENVVLYHFKPDFMLDNLRSN
NYICHLSVFSRALMERSGGGERMEYNGSQDYDLFLRLTEQAEKIVHIPHALYYWRSSPGS
TAADISAKTYCIEAGIAALKAHYERCGVAVDDVTLIPGTPGYYKTDYTIAHPGRVSILIP
TCDHIKDLELCVESIYDRTTYPDFELIIIENNSRQPETFRAYKRMEQEHANLHVVTWQGK
GFNYSALNNFGEKFATGEYLLLLNNDTEVITPNWLEEMVMYAQQKRVGCVGAKLLYPDDT
IQHAGIGFGIGGVAGHLHKYFPAASDGYMGRLNYVQDVYGDTAACLLIRREIYQELNGLD
ESYAVAFNDVDFCVRVREAGYTNVFTPFAQLYHYESKSRGMEDNPEKQKRFQGEVLRFQA
RWGDLLAKGDPCTNPNFDIQREDFALKILPLE

Enzyme Prediction     

No EC number prediction in MGYG000000195_00250.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	278	411	1.6e-23	0.8058823529411765
GT2	536	715	2.9e-19	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	6.11e-84	275	475	1	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	1.20e-38	537	755	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.48e-30	534	760	4	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	7.18e-23	278	475	1	194	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	2.93e-21	279	466	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATO99477.1	0.0	1	812	1	809
QIA42131.1	0.0	1	812	1	809
ATL89683.1	0.0	1	812	1	809
AXA81613.1	0.0	1	812	1	808
CBK99960.1	0.0	1	812	1	808

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	9.38e-09	274	464	4	172	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	3.12e-136	274	806	365	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	2.41e-82	275	810	319	844	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	2.64e-13	263	644	1	396	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
P71054	3.29e-13	273	496	3	226	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
Q4UM29	4.03e-13	275	745	14	498	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000195_00250.