CAZyme Information: MGYG000000195_02311

Basic Information

• Species: Faecalibacterium prausnitzii_E
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_E
• CAZyme ID: MGYG000000195_02311
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	MGYG000000195_7|CGC4	27276.62	7.9502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000195	3389403	Isolate	China	Asia

• Gene Location: Start: 153959; End: 154705 Strand: -

Full Sequence      

MRTLKDLLKRLLCWALLLALLVLAAAGTVLGVQGWKLYRATQPELPAAQLYETLSARPGF
TTCDAIPQTYIDAVIAVEDSRFELHHGVDPVAIVRALWTDLRTRSLAEGGSTLTQQLAKN
IYFTQEKRFARKAAELFAALDIEKHCSKQQIFEMYVNTIYFGSGCYGIAEAAEGYFGKTP
AELTSAECVLLAGLPNAPSAYSPHSSPELALKRSQVVLDRMVSCKKLTKTQARELQDEIA
ALPVLART

Enzyme Prediction     

No EC number prediction in MGYG000000195_02311.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	59	222	1.7e-62	0.9209039548022598

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	7.58e-81	50	222	5	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.45e-76	64	242	8	186	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	5.04e-68	60	238	69	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	8.30e-67	64	238	82	257	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	1.93e-49	62	238	70	246	penicillin-binding protein 1a; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATL90873.1	4.28e-105	4	244	2	240
ATP00668.1	4.28e-105	4	244	2	240
QIA43609.1	4.28e-105	4	244	2	240
QNM09777.1	1.14e-71	16	235	21	240
QYX26381.1	1.70e-68	9	236	5	231

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	3.08e-49	46	234	7	196	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.23e-48	46	234	7	196	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	1.48e-40	66	231	48	213	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
4OON_A	8.18e-37	66	222	47	203	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	6.75e-34	66	231	47	212	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q07259	1.67e-44	14	229	5	217	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
O66874	1.56e-43	32	234	36	239	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q9KNU5	2.13e-42	64	247	72	251	Penicillin-binding protein 1A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcA PE=3 SV=2
P31776	1.29e-40	66	231	63	228	Penicillin-binding protein 1A OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcA PE=1 SV=2
P02918	2.39e-40	22	238	15	246	Penicillin-binding protein 1A OS=Escherichia coli (strain K12) OX=83333 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999996	0.000017	0.000001	0.000000	0.000000	0.000002

TMHMM  Annotations     

start	end
13	35