CAZyme Information: MGYG000000196_00212

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_00212
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
814	MGYG000000196_1|CGC4	93500.41	5.4129

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 279902; End: 282346 Strand: +

Full Sequence      

MKKKINCFIPFGNPKDTIQTVKELQGSELVNKIYLLSADTNKDCLPGCECLLINGLYSTS
TIKTIADNADDASYLLLYTKQTPLKLGLYALERMTQIIQNSSENAMVYADHYQLVDGVLK
QAPVIDYQQGSLRDDFDFGSVLLFNSEIFTLASSILEETVFQYAAFYEMRLMLGNLFQII
HINEFLYTEIETDTRKSGEKQFDYVNPKNREVQIEMEKVCIKHLKEINAYVRPSSRTVNL
DREAFEFEASVIIPVRNRIRTIRDAVNSALSQQTTFPFNVIVIDNHSTDGTTEALQEFSA
DNRLIHIIPQENDLGIGGCWNVGVHHEKCGKFAVQLDSDDLYKDEHTLQKIVDTFYQQNC
AMVIGTYLMTDFQMNEIAPGVIDHKEWTVEDGPNNALRINGLGAPRAFYTPILRKIKFPN
TSYGEDYAIGLSISREYTIGRIYDVIYLCRRWEGNSDAALDIEKINRNNFYKDSIRTWEL
QARIRMHSIDESFQRLVNEMIEKQKKDWKLAKKNYKELEQNLKKEKTLELKLGGDTKRVR
FFPNPQRAISTMAQTDSQSIQERPCFLCNDNRPAEQTSLSLGHYEVCLNPYPIFRRHLTI
IEEEHTPQTIKNRFEDMLFLAENMNEFLILYNGPECGASAPDHMHFQAAGKEEKIANPFG
MTFISDMLSSEDSVHSHLENGFTTSIGISSPNRRGIIEMFEYLYDKIVSIYHDKEPLINV
IAWYGLETVNRTGGDEIKQWNCIIFLRSKHRPECYYAQGKKGLLISPAIAEMCGVFPIVR
EEDLDKITAKKITQIYKEVSLSQEQLKALTDQTS

Enzyme Prediction     

No EC number prediction in MGYG000000196_00212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	250	377	5e-21	0.7352941176470589

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	4.48e-76	613	807	1	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	3.51e-23	251	369	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	7.68e-20	250	366	1	114	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	1.16e-15	250	542	6	270	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06433	GT_2_WfgS_like	2.29e-14	250	365	1	111	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08256.1	0.0	1	814	1	814
AAO78727.1	0.0	1	814	1	814
ALJ44179.1	0.0	1	814	1	814
QMW85996.1	0.0	1	814	1	814
BCA48185.1	0.0	1	814	1	814

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32268	4.50e-08	250	367	9	123	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
A0A0H2UR96	1.70e-07	250	371	6	124	Glycosyltransferase GlyG OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=glyG PE=1 SV=1
Q57287	1.46e-06	250	469	8	240	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000082	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_00212.