CAZyme Information: MGYG000000196_00388

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_00388
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
465	MGYG000000196_2|CGC1	52499.72	6.138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 64597; End: 65994 Strand: +

Full Sequence      

MNYRMMTVAALLVALPACAQKKKAVINDSNTPLHLLQPAYQGTYGDLTPEQVKKDIDRVF
AYIDKETPARVVDKNTGKVITDYTAMGDEAQLERGAFRLASYEWGVTYSALIAAAETTGD
KRYTDYVQNRFRFLAEVAPHFKRVYEEKGKTDSQLLQILTPHALDDAGAVCTAMIKLRLK
DESLPVDGLIQNYFDFIINKEYRLADGTFARNRPQRNTLWLDDMFMGIPAVAQMSRYDKE
AKNKYLAEAVKQFLQFADRMFIPEKGLYRHGWVESSTDHPAFCWARANGWALLTACELLD
VLPEDYPQRPKVMDYFRAHVRGVTALQSGEGFWHQLLDCNDSYLETSATAIYVYCLAHAI
NKGWIDAIAYGPVAQLGWHAVAGKINEEGQVEGTCVGTGMAFDPAFYYYRPVNVYAAHGY
GPVLWAGAEMIRLLNTQHPQMNDSAVQYYQEKQKTTAPIFAVDSE

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	97	432	2.8e-92	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.81e-116	62	434	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.62e-46	102	434	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW86519.1	0.0	1	465	1	465
AAO79281.1	0.0	1	465	1	465
ALJ43459.1	0.0	1	465	1	465
QUT69874.1	0.0	1	465	1	465
QQA07687.1	0.0	1	465	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	0.0	22	465	2	445	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	8.12e-21	242	413	187	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.77e-18	242	413	188	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
5NOA_A	5.75e-18	220	378	158	321	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
1NC5_A	1.75e-17	102	430	41	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.47e-19	220	431	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	9.60e-17	102	430	41	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	1.42e-15	152	432	61	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000977	0.999079	0.000000	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_00388.