CAZyme Information: MGYG000000196_00391

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_00391
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592	MGYG000000196_2|CGC1	67780.21	8.8933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 70940; End: 72718 Strand: +

Full Sequence      

MRTLFFILFFVLGFCYIQARGQKPAHVIITAGQSNTDGRVPNNRLPDYIKAMAVDSTYTA
GAYKYCHIAHNRTDGMFVPFWPLSHPKSKPYTWGYDAIAYYWLEQLFQEDFYVIKWAIGG
TAIAAPVTTPFRGTYWSADPKWLAENTATSEKGKSLLLSLIANIDASIDQTLSKLKQGYQ
IDAFVWHQGESDYEHGKEYYQNLKGVVSYVRNHLTEKTGKDYSELPFIFGTVSRKNKRYN
SDVEEGMRRYAKEDKNAYLIDMSEAELMGDKLHFNQVSAEYMGKQVYEQIKKTLSDDPHV
YVAKYKGDRVCAISYTFDDGLAEHSTVAAPELEKRGFRGTFWVCGYYTEQGASAKVPRMT
WDELREMSKKGHEVSSHSWAHKNAKRLTIEQVKSEIEKNDSAIYANIGIVPRTYCYPYNY
KTEEIVSMASKGRVATRTKQISIGGKSTPERFDKWLKDLMKAEDWGVGMTHGISYGYDAF
KSPSLFWEHLDKVKSMEDQIWVGTFCEVASYIKEREEIQLKVSNKKNGMTITPKLKLDRK
LFAEPLTMVIQGEAMNGILVKQGRKELPVYINGNKVIFDFNPYGGTIKIHFN

Enzyme Prediction     

No EC number prediction in MGYG000000196_00391.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	312	431	2.2e-27	0.8384615384615385

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	2.61e-30	316	431	5	126	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10967	CE4_GLA_like_6s	4.86e-28	311	438	1	122	Putative catalytic NodB homology domain of gellan lyase and similar proteins. This family is represented by the extracellular polysaccharide-degrading enzyme, gellan lyase (gellanase, EC 4.2.2.-), from Bacillus sp. The enzyme acts on gellan exolytically and releases a tetrasaccharide of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the nonreducing terminus. The family also includes many uncharacterized prokaryotic polysaccharide deacetylases, which show high sequence similarity to Bacillus sp. gellan lyase. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
pfam01522	Polysacc_deac_1	6.05e-23	313	431	9	118	Polysaccharide deacetylase. This domain is found in polysaccharide deacetylase. This family of polysaccharide deacetylases includes NodB (nodulation protein B from Rhizobium) which is a chitooligosaccharide deacetylase. It also includes chitin deacetylase from yeast, and endoxylanases which hydrolyzes glucosidic bonds in xylan.
cd10970	CE4_DAC_u1_6s	2.10e-22	312	491	2	193	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 6-stranded beta/alpha barrel. This family contains uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family contain a conserved domain with a 6-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10973	CE4_DAC_u4_5s	3.27e-18	312	429	2	123	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA48724.1	0.0	1	592	35	626
AAO79284.1	0.0	52	592	1	541
QDO67467.1	9.37e-113	260	591	228	562
ALA73864.1	6.00e-109	300	591	334	629
QJR79111.1	6.00e-109	300	591	334	629

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5LFZ_A	5.14e-09	313	418	27	123	T48deacetylase [Arthrobacter sp. AW19M34-1],5LGC_A T48 deacetylase with substrate [Arthrobacter sp. AW19M34-1]
7AX7_A	2.36e-06	313	418	6	103	Crystalstructure of the Xyl-CE4 domain of a multidomain xylanase from the hindgut metagenome of Trinervitermes trinervoides [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H3GDH9	4.45e-06	313	425	268	372	Peptidoglycan-N-acetylglucosamine deacetylase PgdA OS=Listeria monocytogenes serotype 1/2a (strain 10403S) OX=393133 GN=pgdA PE=2 SV=1
A0A3Q0NBH7	4.45e-06	313	425	268	372	Peptidoglycan-N-acetylglucosamine deacetylase PgdA OS=Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness) OX=1334565 GN=pgdA PE=1 SV=1
Q8Y9V5	4.45e-06	313	425	268	372	Peptidoglycan-N-acetylglucosamine deacetylase PgdA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=pgdA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000217	0.999171	0.000157	0.000143	0.000133	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_00391.