CAZyme Information: MGYG000000196_00488

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_00488
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410		47505.42	8.2878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 188195; End: 189427 Strand: -

Full Sequence      

MNKNIVIIQFENASPSGVVRYIQMLLEGLKLRNDFKIHVICLNTNIIFPKVELVGNKVIA
NIPFPPDSKPLRYENYWLTKYFEVVSDLLIPYFKNKEKVIWHVQELFLVKLANILKNSIG
GYVLTHLHIIPWKFSIEFNENHFKKLYSQWLNNIFDLISKNQLENIAYPLSDRIICVSDS
AKKHIISAYHIYPNKISVVYNGLDHHIERTLQKDKKETNEILFVGRISREKGVIGLLNAL
SIAYNRGHSYKLKLVGKCTGYMSSYIRKAYKQLDIEMLGVVSFNELKKLYSESTIGIIPS
LHEQCSYVAIEMSMFGLPIIVSDVDALSEMFEDEINALKIPLLFDEDFGLELNEDKLADT
IIRLMNEKALRQKLSKNAIKNYQEKFTLANMIENTISVYNQLIEQDQCLR

Enzyme Prediction     

No EC number prediction in MGYG000000196_00488.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	214	375	2.1e-22	0.9625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	5.97e-58	6	400	4	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
TIGR04157	glyco_rSAM_CFB	5.82e-56	13	399	11	405	glycosyltransferase, GG-Bacteroidales peptide system. Members of this protein family are predicted glycosyltransferases that occur in conserved gene neighborhoods in various members of the Bacteroidales. These neighborhoods feature a radical SAM enzyme predicted to act in peptide modification (family TIGR04148), peptides from family TIGR04149 with a characteristic GG cleavage motif, and several other proteins.
COG0438	RfaB	9.90e-36	2	405	1	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	5.38e-34	5	396	2	361	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03808	GT4_CapM-like	7.28e-26	163	395	132	357	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA10744.1	9.82e-300	1	410	2	411
QUT69969.1	2.12e-215	1	406	2	406
BCA48828.1	2.34e-212	1	406	2	406
QMW86620.1	2.34e-212	1	406	2	406
AAO79387.1	2.34e-212	1	406	2	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVP_A	2.37e-10	163	402	146	399	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	7.28e-24	121	404	104	386	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
Q48453	7.64e-13	78	399	21	355	Uncharacterized 41.2 kDa protein in cps region OS=Klebsiella pneumoniae OX=573 PE=4 SV=1
P39862	2.86e-10	163	407	130	378	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1
P9WMZ0	2.94e-10	163	402	132	385	Alpha-maltose-1-phosphate synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glgM PE=3 SV=1
P9WMZ1	2.94e-10	163	402	132	385	Alpha-maltose-1-phosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgM PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_00488.