CAZyme Information: MGYG000000196_01749

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_01749
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000000196_6|CGC6	45976.29	6.4986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 228033; End: 229232 Strand: +

Full Sequence      

MRRSSFYKFLILVIIMSSTISLSAQQVDEKLPWSVRMTESEMIRCPESWQLDFQPRLKWD
YCHGLELGAMLDVYDTYGDKKIRDYAIAYADTMVHEDGSITAYKLTDYSLDRINSGKILF
RIYEQTKDEKYKKALDLLYSQFAGQPRNEDGGFWHKKIYPHQMWLDGLYMGAPFYAEYAF
RNNRPQDYADVINQFITCARHTYDPKNGLYRHACDVSRTERWADPVTGQSKHCWGRALGW
YAMALVDVLDFIPKHEAGRDSLLAILDNVAVQVKKLQDPETGGWYQVMDRSGDKGNYLES
SCSAMFIYSLFKAVRMGYIDPSYLDVAKAGYEGFLKNFIEVDKDGVVTITKACAVAGLGG
KVYRSGDYDYYINETIRNNDPKAVGPFIMASLEYERLQK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	52	396	6e-123	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.89e-145	33	398	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.16e-103	53	397	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA07820.1	4.52e-306	1	399	1	399
AAO79213.1	4.52e-306	1	399	1	399
QMW86461.1	4.52e-306	1	399	1	399
QUT69788.1	4.52e-306	1	399	1	399
ALJ43643.1	4.52e-306	1	399	1	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.76e-116	59	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.96e-79	52	397	32	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.17e-79	52	397	22	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.35e-20	61	397	82	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	5.71e-19	42	337	48	331	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.07e-78	52	397	32	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.67e-43	170	393	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.67e-43	170	393	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000217	0.999179	0.000143	0.000161	0.000141	0.000126

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_01749.