CAZyme Information: MGYG000000196_01756

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_01756
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
497	MGYG000000196_6|CGC7	54628.75	6.5611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 244447; End: 245940 Strand: -

Full Sequence      

MNKKILIGLCALFMLPSIQGNTNTDNSYKENITPDRSKVPAFPGADGAGKYTTGGAGGTV
YTVTSLADDGSEGTFRWAINKKGPRTIVFAVSGIIELQKPLKLSNGDVTIAGQTAPGDGI
CLKNYTFSIQADNVIVRFIRSRMGADIKQKGDDAMNGTKGNSNIIIDHCSLSWCTDECAT
FYDNSQFTLQWCIISESLANSIHEKGAHGYGGIWGGQKASFHHNLLAHHTNRTPRLCGSR
YTGKPEEEKVELFNNVIYNYGSDGAYAGEGGSYNFLNNYYKPGPYSATKGSYRRLFTAYA
DDGKNQNEAGVHGIFHFKGNFMDATCPSLTDKQKEALYKVNMDNTFGLIVKNDFAPEKNL
LSKKAFDIAEHTSLQPAKKAYKDVLQFAGASHRRDAVDQRIVEETRKGNYTYEGSHGSTN
GMVDQPIDVGGWPEYKSEPTPTDSDGDGIPDEWEKKYNLNPNDPSDGAQYGLSKEYTNLE
VYLNELVNHLYPADSKK

Enzyme Prediction     

No EC number prediction in MGYG000000196_01756.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	92	280	7e-78	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3866	PelB	3.48e-10	1	290	1	287	Pectate lyase [Carbohydrate transport and metabolism].
smart00656	Amb_all	5.46e-05	105	272	15	175	Amb_all domain.
pfam18884	TSP3_bac	5.93e-04	443	464	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT69795.1	0.0	1	497	1	497
ALJ43636.1	0.0	1	497	1	497
QMW86467.1	0.0	1	497	1	497
BCA48652.1	0.0	1	497	1	497
AAO79220.1	0.0	1	497	1	497

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2UB83	4.61e-44	37	491	18	418	Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=plyC PE=3 SV=1
B8NQQ7	4.61e-44	37	491	18	418	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
Q5B297	2.47e-43	41	496	22	420	Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyC PE=3 SV=1
Q4WL88	1.21e-41	41	491	23	419	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B0XMA2	1.68e-41	41	491	23	419	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000517	0.997399	0.001490	0.000201	0.000197	0.000183

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_01756.