CAZyme Information: MGYG000000196_02816

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_02816
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528	MGYG000000196_11|CGC2	59918.67	7.369

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 214836; End: 216422 Strand: -

Full Sequence      

MNYKLLSVALAFLYIGMVGGCSQPAPDLRYQIEVDKPLQTMEHFGASDAWSMHILGLWAQ
EKQNQIADWLFSTENDANGKPKGIGLSLWRFNVGAGSTEQREASQIGSSWMRTECFMNAD
GTYDWNKQQGQRNFLKLAKERGVTKFLAFLNSPPVYYTQNGLATNTGRGGTANLKPECYE
KYARFLADVVEGIEKHDGIKFNYICPFNEPDGHWNWVGPKQEGSPATNREVARTVRLLSR
EFVNRKMDTQIMVNESSDYRCMLRTHQTDWQRGYQIQAFFCPDSVDTYLGDTPNVPRLML
GHSYWTTTPLSELRAMRCQLREALDKYNVGFWQSETCIMGNDEEIGGGHGFDRTMKTALY
VARIIHHDIVYAGAKSWQWWRAVGGDYKDGLIREYTNDDLKDGRVEDSKLMWALGNYSRF
IRPGAVRLSISAFDQAGNLIPGGDTDQKGLMCSAYKNADGSYAVVLINYAQEDKEFSINK
INGKKTRWQVYRTSDVEGEDLLPVEKVKSGRTVRIPARSIITLLNQSL

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	30	523	1.2e-196	0.9917355371900827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	5.71e-142	32	392	6	366	O-Glycosyl hydrolase family 30.
COG5520	XynC	5.67e-12	1	479	1	406	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam17189	Glyco_hydro_30C	7.19e-07	424	523	1	63	Glycosyl hydrolase family 30 beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08782.1	0.0	1	528	1	528
QMW85467.1	0.0	1	528	1	528
AAO78149.1	0.0	1	528	1	528
ALJ39677.1	0.0	1	528	1	528
QUT40997.1	0.0	1	528	1	528

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	6.38e-89	39	524	17	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6M5Z_A	2.31e-15	39	524	34	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
7O0E_A	5.37e-15	32	524	7	446	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	3.30e-14	32	524	14	453	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
1NOF_A	8.47e-10	105	494	44	349	ChainA, xylanase [Dickeya chrysanthemi],2Y24_A Chain A, XYLANASE [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	8.02e-16	40	424	34	381	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	5.86e-15	32	524	31	470	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000057	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_02816.