CAZyme Information: MGYG000000196_02823

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_02823
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321		36322.82	8.3797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 231380; End: 232345 Strand: -

Full Sequence      

MLLPRKIVFFLLLFVGLSLYAQQNCFISSYVRGNFYNRGRISAESLRASDDLIFLNVRPN
KDGSLSFENPRIFENGKGVTSWEELIKSVRADVKGTKTKLRLGAASGEWKAMVADEAARV
AFAKNIKKILEKNKLDGIDLDFEWAETEKEYEDYSLAILKMREVLGDKYVFSVSLHPVCY
KISKEAIAAVDFISYQCYGPSPVRFPMEKYCSDIQMALAYGIPKEKLVAGVPFYGVTKDG
SKKTEAYFSFVQDGLITGPAQNEVTYKGDVYVFDGQNNIRAKTRYAMDQQLKGMMSWDLA
TDMPLNDSRSLFKTMVEELGR

Enzyme Prediction     

No EC number prediction in MGYG000000196_02823.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	65	311	6.6e-37	0.8412162162162162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00704	Glyco_hydro_18	3.54e-28	54	302	30	307	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	4.05e-26	30	302	11	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	6.72e-25	54	302	33	334	Glyco_18 domain.
cd02879	GH18_plant_chitinase_class_V	1.42e-14	87	302	58	293	The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes. The GH18 domain of the class V chitinases has endochitinase activity in some cases and no catalytic activity in others. Included in this family is a lectin found in black locust (Robinia pseudoacacia) bark, which binds chitin but lacks chitinase activity. Also included is a chitinase-related receptor-like kinase (CHRK1) from tobacco (Nicotiana tabacum), with an N-terminal GH18 domain and a C-terminal kinase domain, which is thought to be part of a plant signaling pathway. The GH18 domain of CHRK1 is expressed extracellularly where it binds chitin but lacks chitinase activity.
cd00598	GH18_chitinase-like	2.81e-14	86	299	55	207	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW85474.1	2.06e-233	1	321	1	321
QQA08775.1	2.06e-233	1	321	1	321
ALJ39670.1	2.06e-233	1	321	1	321
QUT41003.1	2.06e-233	1	321	1	321
AAO78156.1	2.06e-233	1	321	1	321

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6XYZ_A	1.57e-16	39	302	21	290	Crystalstructure of the GH18 chitinase ChiB from the chitin utilization locus of Flavobacterium johnsoniae [Flavobacterium johnsoniae UW101]
4MNJ_A	3.23e-11	83	303	56	334	CrystalStructure of GH18 Chitinase from Cycad, Cycas revoluta [Cycas revoluta],4MNK_A Crystal Structure of GH18 Chitinase from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta],4R5E_A Chain A, Chitinase A [Cycas revoluta]
6TSB_AAA	4.69e-11	24	302	35	337	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	5.00e-11	24	302	54	356	ChainAAA, Peroxiredoxin [Clostridioides difficile 630]
3WIJ_A	7.83e-11	83	303	56	334	Crystalstructure of a plant class V chitinase mutant from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07254	2.76e-10	42	302	203	544	Chitinase A OS=Serratia marcescens OX=615 GN=chiA PE=1 SV=3
Q9W092	3.43e-09	106	302	131	389	Probable chitinase 2 OS=Drosophila melanogaster OX=7227 GN=Cht2 PE=1 SV=1
C5P230	4.23e-08	30	320	44	399	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
P0CB51	3.19e-07	30	320	44	399	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
Q1E3R8	3.19e-07	30	320	44	399	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000910	0.998183	0.000340	0.000181	0.000180	0.000189

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_02823.