CAZyme Information: MGYG000000196_03068

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_03068
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000000196_13|CGC3	45858.71	5.3103

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 99284; End: 100474 Strand: -

Full Sequence      

MKALRFLLIIVCAYFLASCVSTKQADSNSNLDRARQTLDSLYLNYSVSNSHLLRENYPFN
EQYKVTYLASENQANMPNQFSYLWPYSGTFSAVNALLEATHDKKYQQLLEKQVLPGLEEY
FDTERTPVAYSSYIRTAPTSDRFYDDNIWVGIDFIDIYQITKEKKYLDKAQLIWNFIESG
TDSLLGDGIYWCEQKKESKNTCSNAPGSVFALKLFKATNDSLYFKRGKELYKWTQKNLQD
STDYLYFDNIRLDGKIGKAKFAYNSGQMMQSAALLYQLTKNPDYLEDAQSIAKECYNYFF
TDFTTDTGESLKMLKQGNIWFTAVMLRGFIELYQLDQNKTFIDAFNQCLSYAWDNARDEN
GLFGTDLTGNNNNNKKKWLLTQAAMVEMYSRLAAIQ

Enzyme Prediction     

EC	3.2.1.101

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	56	374	6e-70	0.8631284916201117

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	8.93e-29	78	302	30	258	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
COG4833	COG4833	7.35e-12	47	266	10	212	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT41211.1	9.20e-286	1	396	1	395
QMW85700.1	9.26e-270	1	396	1	395
AAO78407.1	9.26e-270	1	396	1	395
ALJ44514.1	2.61e-237	1	396	1	395
QUT73400.1	1.44e-234	1	396	1	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MU9_A	1.50e-104	34	392	8	362	Crystalstructure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482],4MU9_B Crystal structure of a putative glycosylhydrolase (BT_3782) from Bacteroides thetaiotaomicron VPI-5482 at 1.89 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6U4Z_A	3.04e-66	83	393	169	492	CrystalStructure of a family 76 glycoside hydrolase from a bovine Bacteroides thetaiotaomicron strain [Bacteroides thetaiotaomicron]
4C1S_A	3.03e-64	83	396	45	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	1.00e-21	143	332	133	323	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	4.68e-21	61	332	64	324	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000038	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_03068.