CAZyme Information: MGYG000000196_03338

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_03338
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1133	MGYG000000196_15|CGC3	126946.13	6.3065

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 94149; End: 97550 Strand: -

Full Sequence      

MLYLCILCGWTSVSVDAKQDDKTAGRYTLSLDGGEWHLWQDKQAEWKNDKLFLPEDATDL
SLLPVNVPTGGWEQLNPANATAVQVPGTVEEYCTVSSRPSPDDGAGVSWWFRTIKLPATL
KGRRVLIHFESVRMRAEIYLDRKLVGYDMIGESPFDVDITEAVKPGEEQLLAVRVTHPGG
NFHWQDFTEMNWGSYQIPPGRSFGGIIGRVRLDAVSPLFISDIYMQNQPEYTKVKAILTV
NNTLMNTEKGQLMFTVAEKENPSRIIARRDLKNVILQKGENTITMDLNCPNAKLWNLDSP
HLYVCRVELKSAKRIWDADSRTFGFRWFEPTGIGKDAQLRLNGQRVMLLTAISWGYWPVG
GLYATPEMAEKQILTAKALGLNMLNFHRSIGSPVVLEKADELGLLYLEEPGAFHSAGHDP
FIRTIVNTKLQRMILRDRSHPSLVIYNLINEWGGPRARDKELTALRMEDMKKAHAIDPSR
VMTFTSGWASAEHSEEDAKANLLPFDSVLHRKGWFDNHRAAGPATWEEDYYRGPKDNLMY
TDNRTEIYIRGEEGALSTPPRIAEIAKEIEQTGIKGWDGLFWKNQYEAFQQFFHEKNLAP
YFGSIDSLTRAMGDVSFDHQGRRIQGMRMQNTGDVYAVNGWEAMPYDNHSGIVDIYRNCK
GNPSTFTYYTQPLYVAVSPRTQFVHLPGKVPVDFYIVNEKNLSGKYRLSVFVCTPDGKEG
KHIEKEVHITGGDCFGQLLLEHCQLEIEGVSGLYQVKAQLRNASGHLCAEGKDEVLGIYW
DKKQLKGKGALYGTPDDPVATFYQKATGCELPAFHSDIEKLDWIVVTRSSLDAPQPVPVE
AFCQKEGKSVLELSLYKDDDLRTLAGVTQDNKIDRTFADGAQPDPLLPANQSFSAIWDGK
LKAPQSGTYMIGVTSDQGMRLSVNGQRIVDEWRNNKELTVVRPFLLKAGDEVAVRVEYSQ
RNPTGSVQLVWSLPDHAAIAPQELLDRVKEDGTSLLLLKSAESWMDAVSAYTGSAYHGYY
SVGKNWVGGVHFVKEHPLFNGLPVNVAMGWPYQALVRNGDRRLGLHIDNEELVAGSYGSA
PFNLGSAVGIISCGKGKIYYSTLDLVDNLNNPAAAADVARKLFCNFILLSKDR

Enzyme Prediction     

No EC number prediction in MGYG000000196_03338.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	17	523	1.6e-72	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07691	PA14	8.70e-36	847	983	1	139	PA14 domain. This domain forms an insert in bacterial beta-glucosidases and is found in other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins, including anthrax protective antigen (PA). The domain also occurs in a Dictyostelium prespore-cell-inducing factor Psi and in fibrocystin, the mammalian protein whose mutation leads to polycystic kidney and hepatic disease. The crystal structure of PA shows that this domain (named PA14 after its location in the PA20 pro-peptide) has a beta-barrel structure. The PA14 domain sequence suggests a binding function, rather than a catalytic role. The PA14 domain distribution is compatible with carbohydrate binding.
COG3250	LacZ	7.41e-30	102	455	77	410	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
smart00758	PA14	1.75e-27	849	983	1	135	domain in bacterial beta-glucosidases other glycosidases, glycosyltransferases, proteases, amidases, yeast adhesins, and bacterial toxins.
PRK10340	ebgA	3.69e-18	112	500	115	480	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	8.80e-16	23	486	7	449	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08720.1	0.0	1	1133	1	1133
QMW85532.1	0.0	1	1133	1	1133
AAO78220.1	0.0	1	1133	1	1133
QUT41054.1	0.0	1	890	1	891
QDO68997.1	0.0	25	1130	22	1128

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.42e-25	106	496	96	494	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
6ED1_A	1.46e-24	106	481	77	448	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]
6B6L_A	4.85e-24	72	451	34	405	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	8.47e-24	72	451	34	405	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	1.70e-21	72	483	54	448	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P77989	1.27e-25	49	480	11	410	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	7.69e-25	106	496	87	485	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P26257	4.01e-23	125	480	73	411	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
Q56307	8.22e-18	99	453	105	443	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	1.22e-16	16	454	46	485	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000657	0.998582	0.000198	0.000197	0.000167	0.000155

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_03338.