CAZyme Information: MGYG000000196_03567

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_03567
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
633	MGYG000000196_17|CGC1	73121.82	8.7035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 55516; End: 57417 Strand: +

Full Sequence      

MKDIIRFILKLVQNPIVLAILWFGVAIRGFWVSWTEGLANNYLIFSRSFFHALEQTPLYV
EYPKEYFDLFLYGIPFTLLIAPFSIMPTMVGSALWSLCNALLLYFAIKKLEFEKWKTAII
IWLSYNGLYLSVVTQQYNAAVAAFILFTFILVERKKDFWAALMIVLGTLTKIYGIVGLAF
FLFSKRKLYFLWGILFWAFVLFVVPMFYTSPQYVFDSYKEWVSILVVKNDVNELSFYQNI
SLLGMVRKITHAVEYSDMWLIIPGIVLFLLPYLRIGQYENRNFRLSFLASVLLFMVLFST
GTEECGYVGALIGVGIWYVSTPTYKKSFVLNTCLLLFCFVLTAASSSSILFSKHFRTEYI
TSFALKALPCAIIWFKIIWEQLTQDYTSRTPTPFLHKKDDERIDVILPCYNPHEGWEQQL
IEKHKELEGMLNGYNIRFIVVNDGSKRGFTEEAVLRLTNNLPNTIIVDNKINQGKGAAVR
DGIAHSDSELALYTDYDFPYKIESVCQVIKYLEEGYDVVVANRNHTYYSQLSTRRKLASH
ASRFLNFMLLGLTHTDTQGGLKGFNCKGKAFLASTRIKQFLFDTEFIYKASLDDTTFIKE
VPVDLRGEVMLPDMKKGVFVNELKNLLMICWRG

Enzyme Prediction     

No EC number prediction in MGYG000000196_03567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	404	556	7e-19	0.8470588235294118

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09594	GT87	2.16e-36	70	296	1	235	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
cd04188	DPG_synthase	1.28e-29	405	604	1	203	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
cd04179	DPM_DPG-synthase_like	2.07e-27	405	590	1	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
pfam00535	Glycos_transf_2	6.29e-15	404	567	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
PTZ00260	PTZ00260	4.32e-13	386	604	55	287	dolichyl-phosphate beta-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQA08480.1	0.0	1	633	1	633
ALJ44426.1	0.0	1	633	1	633
QMW85777.1	0.0	1	633	1	633
AAO78494.1	0.0	1	633	1	633
QUT73486.1	0.0	1	633	1	633

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2DSR8	7.82e-11	388	587	60	267	Dolichyl-phosphate beta-glucosyltransferase ALG5E OS=Trichomonas vaginalis OX=5722 GN=ALG5E PE=1 SV=1
A2DZE8	1.05e-09	388	629	60	307	Dolichyl-phosphate beta-glucosyltransferase ALG5A OS=Trichomonas vaginalis OX=5722 GN=ALG5A PE=1 SV=1
A2EK20	4.75e-09	331	629	11	310	Dolichyl-phosphate beta-glucosyltransferase ALG5B OS=Trichomonas vaginalis OX=5722 GN=ALG5B PE=1 SV=1
A2ELE6	3.63e-08	388	604	63	289	Dolichyl-phosphate beta-glucosyltransferase ALG5C OS=Trichomonas vaginalis OX=5722 GN=ALG5C PE=1 SV=1
Q45539	1.94e-07	403	546	6	144	Putative glycosyltransferase CsbB OS=Bacillus subtilis (strain 168) OX=224308 GN=csbB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999959	0.000051	0.000001	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
7	29
85	107
128	150
160	182
189	208
259	276
283	302
306	321
328	350