CAZyme Information: MGYG000000196_03797

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_03797
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000000196_19|CGC1	34602.69	4.3486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 35674; End: 36624 Strand: -

Full Sequence      

MAASAVLCSFALLSGCSDDDVCKVYIPEAKTLQIKNFDLGEELREVFHVAVTASDYVTRS
GKEVGGDVKVQLTVDEAKVQEYNSLCGTDYPLLPSDCYTLTTETVIPAGESSSADLVLTV
NAQGKIQPFDSYLLPVTITSVEGAQADHIQQTVYYLLSGAEDVWAMPLADRSAWQVVEVS
SEETSGEGSDNGHAIHAFDGLKGTFWHTQWKGNEPQPPHHIVVDMGQEVKMLGFQYVSRD
HGEAWPQEMTMETSLDGSKWESAGTYSDLPAGAKEEFRSYFPGFKQARYFRLTITAVYSG
KWATAVAEINAISIIK

Enzyme Prediction     

No EC number prediction in MGYG000000196_03797.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	180	310	1.2e-19	0.9516129032258065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08522	DUF1735	4.22e-25	23	144	4	119	Domain of unknown function (DUF1735). This domain of unknown function is found in a number of bacterial proteins including acylhydrolases. The structure of this domain has a beta-sandwich fold.
pfam00754	F5_F8_type_C	1.58e-18	184	309	4	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd00057	FA58C	8.21e-06	179	300	16	134	Substituted updates: Jan 31, 2002

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ40423.1	4.87e-234	1	316	1	316
QUT72456.1	4.87e-234	1	316	1	316
QMW89084.1	1.98e-233	1	316	1	316
AAO77301.1	1.98e-233	1	316	1	316
QQA10624.1	5.69e-233	1	316	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3F2Z_A	9.67e-22	171	310	7	144	Crystalstructure of the C-terminal domain of a chitobiase (BF3579) from Bacteroides fragilis, Northeast Structural Genomics Consortium Target BfR260B [Bacteroides fragilis NCTC 9343]
2KD7_A	2.43e-16	171	310	7	144	ChainA, Putative chitobiase [Bacteroides thetaiotaomicron VPI-5482]
3GGL_A	2.09e-15	171	310	17	154	X-RayStructure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. [Bacteroides thetaiotaomicron],6OE2_A X-Ray Structure of the C-terminal domain (277-440) of Putative chitobiase from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR324A. Re-refinement of 3GGL with correct metal Mn replacing Zn. New metal confirmed with PIXE analysis of original sample. [Bacteroides thetaiotaomicron]
2J7M_A	4.92e-11	177	310	13	146	Characterizationof a Family 32 CBM [Clostridium perfringens]
2J1A_A	5.02e-11	177	310	14	147	Structureof CBM32 from Clostridium perfringens beta-N- acetylhexosaminidase GH84C in complex with galactose [Clostridium perfringens ATCC 13124],2J1E_A High Resolution Crystal Structure of CBM32 from a N-acetyl-beta- hexosaminidase in complex with lacNAc [Clostridium perfringens ATCC 13124]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0TR53	4.36e-09	177	310	631	764	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	4.36e-09	177	310	631	764	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000145	0.014442	0.985427	0.000008	0.000011	0.000007

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_03797.