CAZyme Information: MGYG000000196_04714

Basic Information

• Species: Bacteroides thetaiotaomicron
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides thetaiotaomicron
• CAZyme ID: MGYG000000196_04714
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	MGYG000000196_31|CGC1	80672.17	8.4828

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000196	6397474	Isolate	China	Asia

• Gene Location: Start: 42909; End: 45017 Strand: +

Full Sequence      

MKFKYILILSALIGQILSLSAREVTSFNEGWLFKRGPFSQDPVKVAAQWNADWETVNLPH
TWNAKDMQVKADAFYEGVGYYRKTQFFGNDLKGKRVFLRFEGVGANTEVYVNGKLVGMHR
GAYSAFAFEIGTALKLGAENEIMVKADNASRPDVIPVNHNLFGVYGGIYRPVWLIITEQN
NITVTDCASPGVYITQKNVSKRSADITVKVKLDNGSLTPADLVLENTIYTQNGKKVTSHR
LPLVLTPQGTQTYISTFKLNKPHLWQGRKDPYLYKVISRLLADGKVIDEVVQPLGVRRYE
IVAGKGFYLNGEKYPMYGVTRHQDWWGLGSALTNKEHDFDLAQIMDIGATTVRFAHYQQS
DYLYSRCDSLGLVIWAEIPFVNRVTGYEAENAQSQLRELIRQSFNHPSIYVWGLHNEVYQ
PHEYTAGLTQTLHNLAKTEDPDRYTVSVNGYGHAEHPVNQNADIQGMNRYFGWYEKKLQD
IEPWVKGLEEKYPWQKLMLTEYGADANLDHQTEYLGDALNWGKSFYPETFQTKTHEYQWS
VIAKHPYIIASYLWNMFDFGVPMWSRGGVPARNLKGLITFDRKIKKDSYYWYKANWSKDP
VLYLTQRRNIDRERKHTSVTVYSNIGTPQVYLNGKELTGIRQGYTDVHYVLADVTLEQGK
NTIKTVATYNGKEYTDEIEWNYTGEKKRSADWSENKEEHAGW

Enzyme Prediction     

No EC number prediction in MGYG000000196_04714.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	692	7.7e-91	0.7313829787234043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	2.44e-53	22	600	10	596	beta-D-glucuronidase; Provisional
COG3250	LacZ	6.78e-45	22	492	10	507	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.45e-26	51	417	69	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	9.04e-18	302	560	3	266	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam00703	Glyco_hydro_2	3.41e-15	192	297	6	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT40945.1	0.0	1	702	1	702
QQA08828.1	0.0	1	702	1	702
BCA52299.1	0.0	1	702	1	702
AAO78075.1	0.0	1	702	1	702
QMW85395.1	0.0	1	702	1	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FN9_A	0.0	21	701	4	684	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	7.61e-146	18	687	19	679	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
3CMG_A	2.04e-145	19	687	1	660	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVG_A	4.21e-122	22	637	25	619	Crystalstructure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_B Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_C Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus]
6MVH_A	4.55e-122	22	677	25	651	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	4.10e-88	20	690	49	728	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	1.17e-53	15	635	19	639	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	2.04e-52	20	672	40	727	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	3.05e-51	22	672	46	698	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	8.89e-48	22	438	3	409	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000418	0.998890	0.000212	0.000158	0.000151	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000196_04714.