CAZyme Information: MGYG000000198_00110

Basic Information

• Species: Enterocloster citroniae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster citroniae
• CAZyme ID: MGYG000000198_00110
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MGYG000000198_1|CGC2	56120.35	6.2405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000198	6476049	Isolate	China	Asia

• Gene Location: Start: 113591; End: 115027 Strand: +

Full Sequence      

MVKMQHKFPQGFLWGGAIAASQADGGFREDQKGMSIADFHPYRNIKNRDDRKEDSTIRND
ENFLVIEPGLYYPKQHGVDFYHRFEEDLGLMEEMGFKAFRTSFDWSRIYPKGDEEEPNEA
GLRYYDRLITSIRSHGMEPFMTISHYEMPVHLVKKYGGWLNRSLVDFFAAYCNTLFERYH
GQIKYWIVFNQINLTTFNSLGILGNRAKNFMEAEYQGVHHQFLACARAKELAGKYKGQIR
VGTMLSDKLAYPATCRPEDMLFNMRKNQMQYFFPDVQLRGSYPAYAFRFFEENHINIHID
PEDERLLRENPMDFLSTSYYYTKINDSLKNTYAPMDKSTNPYLEKTEWGWEIDPIGLRVN
LNHYSDRYPGVPIYITENGYGAVDRLEKDGAVHDPYRIDYLRQHVIQMKEAIADGVPLKG
YMMWAPMDIVSCSSAEMKKRYGLIYVDQDDEGNGSGQRYRKDSFYWYQKVIESNGEEL

Enzyme Prediction     

No EC number prediction in MGYG000000198_00110.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	475	6.1e-137	0.9953379953379954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09852	PRK09852	0.0	8	478	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
COG2723	BglB	3.37e-179	7	477	3	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	3.79e-169	7	478	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	1.11e-166	8	478	6	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.82e-149	7	478	5	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBB49316.1	4.80e-233	3	478	4	478
BAD39939.1	3.93e-227	8	478	8	476
CBG21155.1	3.93e-227	8	478	8	476
CBK89201.1	4.10e-196	1	478	1	481
APB71184.1	7.54e-192	8	478	8	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	7.33e-163	1	478	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	8.02e-154	8	478	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
3QOM_A	7.06e-143	8	478	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]
4F66_A	9.68e-143	7	478	6	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
2XHY_A	1.88e-142	1	478	1	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40740	2.83e-162	1	478	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.62e-152	8	478	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P42973	7.72e-152	9	478	5	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q48409	9.92e-149	8	478	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	2.69e-146	4	478	1	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000039	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000198_00110.