CAZyme Information: MGYG000000198_00674

Basic Information

• Species: Enterocloster citroniae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster citroniae
• CAZyme ID: MGYG000000198_00674
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469		52970.91	5.7528

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000198	6476049	Isolate	China	Asia

• Gene Location: Start: 722001; End: 723410 Strand: +

Full Sequence      

MRYEDKRVNDIRIAYIGGGSRGWARTFMTDLAMESSISGTIRLYDIDAEASRANEIIGNR
LSQRPEAAGKWTYETCMSLEEALTGADFVVISILPGTFDEMAVDVHMPERLGIYQSVGDT
AGPGGMIRALRTIPMYVEFAKAIRDYAPRAWVINYTNPMSLCVKTLYHVFPQIKAFGCCH
EVFGTQKVLKGLLEDTMGLKGINRKDIRVNVLGINHFTWFDYASYEGIDLFPMYRKYVDE
HFEEGYAERDTNWANACFACAHRVKFDLFRRYGLIAAAGDRHLAEFMPGDEYLKDPETVA
RWKFGLTSVDWRKEDLEKRMEKSRKLLCGETEIDLKPTGEEGILLIKALCGLERVVSNVN
IPNTGLQIPNLPAGAVVETNAVFERDAIRPVLAGSVPEPVKALIMPAVENHETILEAALT
CNEELVVQAFMNDPQVRGRNCREEDIRKLVRDMVEGTIKYLPKAWAVRK

Enzyme Prediction     

No EC number prediction in MGYG000000198_00674.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	190	8.1e-56	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	3.05e-169	11	454	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.29e-103	11	463	4	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	2.10e-78	12	464	3	430	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	1.69e-56	12	193	1	181	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	8.25e-48	11	455	1	424	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP41858.1	3.89e-303	1	465	1	465
ASN93484.1	3.89e-303	1	465	1	465
QJU22170.1	6.64e-300	1	463	1	463
QOV18776.1	2.61e-278	1	465	1	465
QOV18468.1	6.79e-274	1	465	1	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	2.96e-160	8	437	3	422	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	7.88e-27	11	463	5	436	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1OBB_A	1.08e-26	11	454	4	465	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
1S6Y_A	2.76e-26	5	463	5	439	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
6VC6_A	2.85e-17	13	430	6	410	2.1Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_B 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_C 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_D 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	4.35e-250	1	465	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	5.18e-206	1	468	1	464	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	1.42e-183	1	465	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	4.04e-164	8	455	7	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P30877	1.85e-49	12	468	6	451	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000198_00674.