CAZyme Information: MGYG000000198_02496

Basic Information

• Species: Enterocloster citroniae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster citroniae
• CAZyme ID: MGYG000000198_02496
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000000198_3|CGC5	44163.32	4.7911

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000198	6476049	Isolate	China	Asia

• Gene Location: Start: 605986; End: 607113 Strand: +

Full Sequence      

MEILDCYIDQLLAQSTPQAPVWNIENIKEGRKPNWNYIDGCMINAVIELYYITKKQQFLD
FADGFIDYFVKEDGSILSYNPKEYNLDNVNAGKTLFDLYHLTHREKYRRAMDTVYSQLLG
QPRTSTGNFWHKKIYPNQIWLDGLYMAQPFYMQYETEYNSCKNCMDSYEQFLNVYQLMRD
TRNGLYYHAYDDSRRMFWCDKVTGLSDTFWLRAMGWYAMALIDTMEVMPDFMKEEKKRMN
SIYRELIDAMLPYQDENSGMWYQVVNRGGILPNYLEESGSAIFSYAIMKSVRLGYLPDEY
YCYGERAFNGICKTYLSEKDGKLQLGGICLVAGLGNSDMREGTFDYYMREPVVENDAKGI
APLILAYIETMFRSR

Enzyme Prediction     

No EC number prediction in MGYG000000198_02496.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	370	8.5e-107	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	9.19e-88	35	369	34	352	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	7.33e-79	35	369	27	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU47524.1	6.23e-235	1	373	1	373
QQR03578.1	6.23e-235	1	373	1	373
QIX91776.1	5.11e-234	1	373	1	373
QRP36827.1	9.84e-232	1	373	1	373
ASN98361.1	9.84e-232	1	373	1	373

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	5.77e-98	34	369	22	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.21e-63	8	374	4	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.01e-62	35	374	29	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	1.33e-07	170	313	197	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.31e-06	122	314	147	332	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	6.63e-63	8	374	4	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	3.23e-42	146	375	1	233	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	3.23e-42	146	375	1	233	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000026	0.000003	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000198_02496.