CAZyme Information: MGYG000000199_00124

Basic Information

• Species: Streptococcus parasanguinis_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus parasanguinis_B
• CAZyme ID: MGYG000000199_00124
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
817	MGYG000000199_1|CGC3	89834.12	6.8826

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000199	2066234	Isolate	China	Asia

• Gene Location: Start: 132829; End: 135282 Strand: +

Full Sequence      

MKKKDLIFYAGTAVLLAFSTQQVKADEQHASDQTPENTSAIVATTTSSEAQNTASEEVGV
EKGIQTENTVATEAAPVTPTLSNNQSSDKGTSDKVVSEQPAPAVVASRAPYGARARVVAA
RNESVPQQESPVSADLTIAKSESDGTFTITAKNLQGLDGYEEVKIPFWSHANGMKDIIWY
TPSRQADGSYTVTAKASDHENADGKYEAQVFYVDAKGQNKFVKKAFIDYTAPKPSADLTI
TKSESDGTFTITAKNLQGFDGYKEVKIPFWSHANGMKDIIWYTPTRQADGSYTVTAKASD
HENADGQYEAQVFYVDAQGQNKFVKKAFIDYTAPKPSADLTITKSESDGTFTITAKNLQG
FDGYKEVKIPFWSHANGMKDIIWYTPTRQADGSYTVTAKASDHENADGQYEAQVFYVDAK
GQNKFVKKAFIDFKNQSRPTASLLIQNNNKDAGTFDVIIKDVYSPKGVRTVQVPTWSDKD
GQDDIRWYEATRQSNGDYKVSVKASDHKNSTGKYHIHLYYIQNDGSRVGVGSTTTEVEFR
NAQTKTQTGIKNVNSGAGTYTVTVDQAPQGRRIKNIRVAAWSQAHQENLFWYSTAPSGMH
TEVQVSAANHQYQSGNYTTHVYVDYVDGGVEGFNLGQTALHPRATVDQTAFSPRVTNGQR
DRVLRAAASLVGVRGGTAAHHQLVNDYNSVKPLPVGYAVKTTDDWCDIFVTTVFQREGLS
GLIGRECGVERHIQIFKRLGIWNEDGTTTPKAGDIITFNWDQNSQQNNGFADHIGIVESV
SNGIIHTIEGNSNNQVRRNTYRIGHGNIRGFATPRYQ

Enzyme Prediction     

No EC number prediction in MGYG000000199_00124.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08481	GBS_Bsp-like	1.51e-33	445	533	1	89	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	5.48e-19	241	326	3	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	1.09e-18	343	428	3	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam08481	GBS_Bsp-like	1.98e-18	140	224	4	88	GBS Bsp-like repeat. This domain is found as a repeat in a number of Streptococcus proteins including some hypothetical proteins and Bsp. Bsp is a protein of group B Streptococcus (GBS) which might control cell morphology.
pfam05257	CHAP	1.31e-08	746	791	42	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWL83937.1	0.0	131	817	462	1156
AFJ26940.1	0.0	131	817	680	1374
AEH56405.1	0.0	131	817	574	1268
AGY39024.1	0.0	127	643	459	979
AAN64579.1	1.27e-274	145	817	703	1366

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000392	0.998740	0.000363	0.000167	0.000164	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000199_00124.