CAZyme Information: MGYG000000199_01014

Basic Information

• Species: Streptococcus parasanguinis_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus parasanguinis_B
• CAZyme ID: MGYG000000199_01014
• CAZy Family: GH8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000000199_3|CGC2	42591.42	8.7251

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000199	2066234	Isolate	China	Asia

• Gene Location: Start: 51542; End: 52645 Strand: +

Full Sequence      

MNTKKMRYVWFLVILCIFCLTLFLARTRSKVEMRNRIYRQWNEHFVVSKGKESYVRTTND
SNQTVVLSEAQSYGMLITVAAAEKGQAQQADFDRLYHYYLNHRLEGTQLMSWKQTISNGK
AKDEDHNATDGDLYIAYALLKAAQQWPKQAKDYQAQAKAILEDILAHNYNEETGVLTVGN
WANQDSEFYHLMRTSDTLPAQFQIFYEVTKDSKWLDIKEKMLQQLQTISSQTKTGLLPDF
IWVDEQGTRVADPKTIESKYDGAYSYNACRLPYNLVQSKDKTSQQLVKKMLNFFKSQRNL
YAGYDLKGKALNNHQAASFLAPIVYASEHEKGYLKLVQQNKYIFTQDLPLNNYYDATMTT
MIALELF

Enzyme Prediction     

No EC number prediction in MGYG000000199_01014.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	38	364	4.1e-73	0.98125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01270	Glyco_hydro_8	6.01e-24	38	364	8	317	Glycosyl hydrolases family 8.
COG3405	BcsZ	1.48e-20	5	294	1	275	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
PRK11097	PRK11097	1.97e-11	38	173	28	153	cellulase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEH56684.1	1.54e-233	1	367	1	367
AFJ25304.1	2.54e-232	1	367	1	367
QUB39088.1	8.48e-231	1	367	1	367
AGY40742.1	1.33e-204	1	367	1	367
AGY37425.1	1.33e-204	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XD0_A	4.50e-36	41	322	69	359	ApoStructure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4],5XD0_B Apo Structure of Beta-1,3-1,4-glucanase from Paenibacillus sp.X4 [Paenibacillus sp. X4]
1V5C_A	4.47e-24	68	327	73	340	Thecrystal structure of the inactive form chitosanase from Bacillus sp. K17 at pH3.7 [Bacillus sp. (in: Bacteria)],1V5D_A The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)],1V5D_B The crystal structure of the active form chitosanase from Bacillus sp. K17 at pH6.4 [Bacillus sp. (in: Bacteria)]
7CJU_A	5.01e-24	68	327	79	346	Crystalstructure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7CJU_B Crystal structure of inactive form of chitosanase crystallized by ammonium sulfate [Bacillus sp. K17-2],7XGQ_A Chain A, chitosanase [Bacillus sp. K17-2],7XGQ_B Chain B, chitosanase [Bacillus sp. K17-2]
6VC5_A	1.34e-09	68	361	33	308	1.6Angstrom Resolution Crystal Structure of endoglucanase from Komagataeibacter sucrofermentans [Komagataeibacter sucrofermentans]
1WZZ_A	4.64e-08	68	272	48	242	Structureof endo-beta-1,4-glucanase CMCax from Acetobacter xylinum [Komagataeibacter xylinus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19254	3.42e-35	41	322	69	359	Beta-glucanase OS=Niallia circulans OX=1397 GN=bgc PE=3 SV=1
P29019	1.45e-23	68	326	129	395	Endoglucanase OS=Bacillus sp. (strain KSM-330) OX=72575 PE=1 SV=1
P37696	1.46e-08	68	272	56	250	Probable endoglucanase OS=Komagataeibacter hansenii OX=436 GN=cmcAX PE=1 SV=1
P27032	2.52e-07	56	283	40	256	Minor endoglucanase Y OS=Dickeya dadantii (strain 3937) OX=198628 GN=celY PE=1 SV=1
Q8X5L9	1.20e-06	38	266	28	248	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.939971	0.054050	0.005154	0.000156	0.000116	0.000566

TMHMM  Annotations     

start	end
7	25