CAZyme Information: MGYG000000199_01773

Basic Information

• Species: Streptococcus parasanguinis_B
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus parasanguinis_B
• CAZyme ID: MGYG000000199_01773
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425		48736.36	7.2766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000199	2066234	Isolate	China	Asia

• Gene Location: Start: 40545; End: 41822 Strand: +

Full Sequence      

MKKIKIDVVAVPLSGHLYPTLNLVKPLLDDPTMEIRVFTGPQKKAVAESLGFTVVPILED
KVEVFERVANNDKKHNLFSAYRQLSRSLDLINHVSDQLLEEWRVNRPDIVIADFITLSAG
FVAEELEIPWITTMATQFAIETPYGPPCFFGGMGIARTKKEEKIQALCRKLTRIGKYCGA
FLLRKRLKRYNFKVYNQNGVETIYSPYAIFGIGMMELELKTHFPHQYAWLGPLGTSLEKA
EDYPLDLSPYEDKKKVLVTCGTQLPWAKENLLHQTKQLAKEHPECHFFVTLGDGAKEFSE
EEVAPNVTVVSYLPYKEYIPQMDYVIHHGGAGIFYQCIEFKKPALILPHDYDQFDYAIRG
VEAGIAFQAHRNRTEEIQAGFKALLEKESWEKLERLNKLSKTYKPLDTLEFEIQRLLRRG
TDGKL

Enzyme Prediction     

No EC number prediction in MGYG000000199_01773.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	86	416	1.1e-16	0.7958115183246073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03784	GT1_Gtf-like	1.22e-30	5	396	2	384	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
COG1819	YjiC	4.44e-30	5	403	3	385	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
TIGR01426	MGT	7.69e-11	11	366	3	336	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
pfam04101	Glyco_tran_28_C	0.003	256	351	2	101	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEH55529.1	1.13e-310	1	425	1	425
AFJ26032.1	2.28e-310	1	425	1	425
QWL82965.1	2.28e-310	1	425	1	425
QEW09764.1	2.55e-307	1	425	1	425
QUB38075.1	8.54e-306	1	425	1	425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	3.26e-12	1	365	1	330	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	3.33e-12	1	365	1	330	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
7LVY_A	3.34e-06	302	418	339	458	ChainA, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_A Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_B Chain B, UDP-glycosyltransferase 203A2 [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	1.83e-11	1	365	1	330	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000199_01773.