CAZyme Information: MGYG000000200_01249

Basic Information

• Species: Blautia_A sp003471165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003471165
• CAZyme ID: MGYG000000200_01249
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589	MGYG000000200_6|CGC3	68697.21	4.7377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000200	4192583	Isolate	China	Asia

• Gene Location: Start: 132464; End: 134233 Strand: -

Full Sequence      

MKKITENNYMTVYSNLKINTCVQEENKLQDVKITYVDIEMKQQAEDNKEGTIRLEFVFPA
TDISGRWFPICKFDRSVKADYDSAVESMTASSAPVVCFYNSDGMNRHTIALSEVRQKVFM
KCGIHEEDGNMLCVIEIPVTQGFSEKDLKITIWESIERKKYWEVLDKVRYWWEETLNIMP
AEVPELAKKPMYSFWYSQHQNITAESVEEESLRAAEMGFSAIIVDDGWQTEDNNRGYAYC
GDWEPSQQKFPDFAQHVARVQAMGLKYLLWFSVPYIGKNTKAWERFHDKLLRYNESQQAG
IFDLRYPEVREYLKAIYVKAVKDWNLDGLKLDFIDEFYFQEESPSYNEQMDCHDIQDALN
IFLTDVMDTLKKIRPDILIEFRQRYIGPQIRRYGNIFRVSDCPGSAVSNRTGTIDLRLLS
GSTAVHSDMLMWHPDEKPEDAGLQLLSCLFATVQISVCLDQITDDMKRMLLFWLGFMDEK
REILLHSQIQPEEPENLYPEVCAECGNEKILVHYSKGRLADLRDINKKIYYIHAVKEEEV
CFRCNSSDTLKYEVRDCYGNLMESNEVSANQFVIISVPTSGMVEFTRKL

Enzyme Prediction     

No EC number prediction in MGYG000000200_01249.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.51e-64	187	476	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd06592	GH31_NET37	1.03e-14	188	339	1	157	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
pfam02065	Melibiase	2.30e-13	214	380	67	236	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	3.46e-08	177	333	281	451	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06593	GH31_xylosidase_YicI	7.81e-08	190	333	7	158	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU17504.1	2.36e-255	37	588	36	587
QQQ94451.1	1.56e-198	44	447	43	446
ANU76873.2	3.80e-198	44	447	68	471
ASU29676.1	3.80e-198	44	447	68	471
QUO31288.1	6.22e-180	38	588	35	586

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000009	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000200_01249.