CAZyme Information: MGYG000000200_01448

Basic Information

• Species: Blautia_A sp003471165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003471165
• CAZyme ID: MGYG000000200_01448
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	MGYG000000200_8|CGC1	97584.74	4.4398

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000200	4192583	Isolate	China	Asia

• Gene Location: Start: 42207; End: 44711 Strand: +

Full Sequence      

MIELQLHENWQLCDIKKQDWIPAQVPGDIYSALLKAEKMPDPFFGDNEYQAKALMEEDYE
YRTVFTYDEKQFENCQEVILRFDGIDTIADIYLNECYLGKADNMHRVWEFPVGELLQEGE
NTLRVIIRSPLKFMAEAFKKYKNIGNEDTVEGFMHLRKAHYMSGWDWGACLPDGGIFRPV
TLLGIESARLDSVYIRQVHEDGKVLLIPEVDVETVDEAEIDTDEKNSAEMPDQGVESEAD
EDLLEYEVTVTAPDGTKIASDGSPDEIVIENPQFWWPNGLGEQPLYQVQVDLKAGDKTVD
TWCKKIGLRTLTMHIEKDEWGESFAHEVNGYQVFAMGADYIPEDNLLQRTSKERTRELLL
QCKRANFNTIRVWGGGYYPEDWFFDLCDELGLMVWQDFMFACSVYELTPEFEANIRQEFI
DNIKRIRHHASLALWCGNNEMEMFVKQGNWVTKPTEVRDYLLMYERIIPEVLREYDPDTF
YWPASPSSGGSFDEPNDPNRGDVHYWEVWHGNKPFAEYRKYFFRYASEFGFQSFPSVKTL
ETVTDDPRELNPFSYVMEKHQRNYGGNGKIAKYMQAAYRYPENFSDFVYASQLLQADGIR
YGVEHYRRNRGRCMGAIYWQLNDCWPVISWSSIDYYGRWKALHYYAKRFFAPVMLSCEEQ
SWMTVEADMNRQHFEFEKSIRLNVTNETLSARKVLVKFAVRDASAKILRQEERWVEVPAL
SSVWMDKVELPGIDCFNEYVSYEAWENEKIISQGTVIFSYPKYFHYQDPKLSVRVEGDEI
IVSAEAYAKSVEIQNENDDLILEDNYFDMNAGERRVKILDGKPENLKVRSVYDI

Enzyme Prediction     

No EC number prediction in MGYG000000200_01448.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	766	4.5e-103	0.7433510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.23e-103	6	808	15	799	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	9.70e-16	61	440	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	1.77e-10	768	833	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	5.79e-10	193	309	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	3.14e-08	680	763	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	1	834	15	836
QIB54534.1	0.0	1	834	1	822
QMW79049.1	0.0	1	834	1	822
AWY97345.1	0.0	5	834	5	810
QQQ93614.1	0.0	1	834	1	822

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OP6_A	1.21e-161	6	834	13	842	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2VJX_A	1.56e-161	6	832	11	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	1.66e-161	6	832	13	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	3.19e-161	6	834	11	840	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	1.88e-159	6	832	11	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	1.94e-113	2	832	5	851	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
Q0CCA0	2.14e-112	14	821	20	828	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	1.79e-109	3	667	6	672	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	6.79e-109	3	667	6	672	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	9.48e-109	3	667	6	672	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000085	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000200_01448.