CAZyme Information: MGYG000000200_01920

Basic Information

• Species: Blautia_A sp003471165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003471165
• CAZyme ID: MGYG000000200_01920
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493	MGYG000000200_12|CGC1	57069.78	4.6843

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000200	4192583	Isolate	China	Asia

• Gene Location: Start: 12750; End: 14231 Strand: -

Full Sequence      

MNKILMRQRIENAQKEIDSKKMIVQNGKMRQHYHFMPQSGWMNDPNGLIFFNGQYHVFYQ
TNPYNGFWDCMHWGHAVSKDLVHWEYLPLALAPSEEYDDYQKGGCFSGSAIEHEGKLYVF
YTATANHGNGSEQSQCLAISEDGINFEKYDGNPLFDAPEGIQPDSFRDPKVWKHENKYYM
VVGASRNNRGLALIYESEDLYHWNFLNVLAESRGEWGFMWECPDFYQLGDKYVLTFSPMG
SGDHTSVYLTGDFDYKTGKFDWHISGEMDWGFDFYAPQSMVAPDGRRLIVAWANEWEWMP
LFKDWGPTYQEGWCGFFNVIREVRMCKDGTLAFVPVEEMEKIRENKFTQREIQITETPQQ
LKAGDGISFEMKFTLDLEETDADRVELKLRCGKEKESRCIFDLKNGELLVDRSCADGWSV
GTSRSVLKVSEKSLDVHIFSDQSSLEIFTDQYRNNHSNNIFAGNDQDAISISAFGGRAVI
RDYEAYGLQECFN

Enzyme Prediction     

No EC number prediction in MGYG000000200_01920.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	34	328	2.5e-102	0.9692832764505119

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1621	SacC	3.36e-149	4	479	3	476	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd08996	GH32_FFase	4.32e-139	40	325	1	281	Glycosyl hydrolase family 32, beta-fructosidases. Glycosyl hydrolase family GH32 cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose, thus named invertase (EC 3.2.1.26). This family also contains other fructofuranosidases such as inulinase (EC 3.2.1.7), exo-inulinase (EC 3.2.1.80), levanase (EC 3.2.1.65), and transfructosidases such sucrose:sucrose 1-fructosyltransferase (EC 2.4.1.99), fructan:fructan 1-fructosyltransferase (EC 2.4.1.100), sucrose:fructan 6-fructosyltransferase (EC 2.4.1.10), fructan:fructan 6G-fructosyltransferase (EC 2.4.1.243) and levan fructosyltransferases (EC 2.4.1.-). These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. These enzymes are predicted to display a 5-fold beta-propeller fold as found for GH43 and CH68. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	2.67e-124	34	448	1	433	Glycosyl hydrolases family 32.
TIGR01322	scrB_fam	1.15e-123	23	450	7	432	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
pfam00251	Glyco_hydro_32N	1.92e-121	34	330	1	302	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL21239.1	6.99e-271	6	341	1	336
ASM68475.1	5.18e-268	1	492	1	493
QYX27207.1	1.39e-251	1	489	1	491
AJH00915.2	2.77e-221	10	489	13	493
AGB18152.1	2.03e-220	1	489	1	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7VCO_A	3.05e-102	33	489	29	486	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	3.80e-89	5	465	21	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	5.88e-88	5	465	21	464	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	3.93e-79	30	448	3	393	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]
1W2T_A	1.10e-78	30	448	3	393	beta-fructosidasefrom Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_B beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_C beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_D beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_E beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8],1W2T_F beta-fructosidase from Thermotoga maritima in complex with raffinose [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0DJA7	9.35e-90	33	490	32	501	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) OX=264203 GN=sacA PE=1 SV=1
F8DVG5	1.85e-89	33	490	32	501	Sucrose-6-phosphate hydrolase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) OX=555217 GN=sacA PE=3 SV=1
P40714	3.04e-88	32	481	27	469	Sucrose-6-phosphate hydrolase OS=Escherichia coli OX=562 GN=cscA PE=3 SV=1
P16553	1.97e-85	6	482	1	469	Raffinose invertase OS=Escherichia coli OX=562 GN=rafD PE=3 SV=1
O33833	1.40e-79	30	448	3	393	Beta-fructosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=bfrA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000200_01920.