CAZyme Information: MGYG000000200_02093

Basic Information

• Species: Blautia_A sp003471165
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia_A; Blautia_A sp003471165
• CAZyme ID: MGYG000000200_02093
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834	MGYG000000200_13|CGC1	96662.1	6.1122

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000200	4192583	Isolate	China	Asia

• Gene Location: Start: 70192; End: 72696 Strand: +

Full Sequence      

MGNILWSVDKRIYSDKENHTLTITGWAVAREQKICNFSLYGSGKEISFPELSRYERTDVA
DNLKETKGVKEIKNAGFTIKIPEILQLAQEHESLQLVLQAGNEKEVIWEASAQEIKKFCT
ESLIEYHIDEEQITQGNILTIKGWVVNQMDSDDVFVQNSDGKVLECTITRQRRPDVEEVK
GIPEAEKRNLGFCITVNLENIHSQNICICFRGRDIQKIYKIDVKKLKRENTGFYQQMKLL
SLENRQKNHAYIKENGIGRFFRYVKNSQLKDGEQEYEDWLKDHEAFRKELKRQRNAIFSY
MPLVSVVIVLSDTDVKSLSSVIDAYMDQTYSNWQLCLVDVNQGEETGDFLRKKYKKEIRL
SYKKITEDKGASENLNAALKLAMGDYILFSDQKTVPSPDALFWMIKAVTEKKADMIYTDE
DEVSTDGKHHYDPKFKPDFNLFRLRENNYIGQFWAIRRDVLEQSGKFRPEYDGAQNFDMI
LRCCEQAKKIVHIPRVLCHCMENENGESHKQQKAWEAGRRALEDHYNRTQLPAVAEPADK
AGWYRTHLAIQSEPMISIIIPSKDHINDLDLCVSSIEEKTTWKNYEIIIVENNSVEKETF
VYYETLKSRYPNVRILTWKKEFNYSAINNFAVREAQGEYLLFLNNDVEIITDSWLEEMLQ
FCQLKGVGMVGAKLYYLDDTIQHAGVVVGLGGVAAHVLCKLPGDAEGYMGRLRCVQEMSA
VTAACMMVKTSVFKAVGGFDEELKVAFNDIDLCMKVRDKGEKILFTPYAELYHYESKSRG
MEDTPEKQLRFSREVNCFRRKWERELLKGDPYYNPNLTLNNTDCSLRKLERNGD

Enzyme Prediction     

No EC number prediction in MGYG000000200_02093.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	557	677	2.6e-20	0.6941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	2.53e-64	302	499	1	199	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	8.77e-44	558	775	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	2.33e-27	552	780	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	9.65e-17	557	676	1	117	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	1.13e-14	305	500	1	193	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL24562.1	1.17e-283	1	828	1	811
QOV20089.1	3.71e-192	43	829	38	814
CBL36811.1	1.75e-187	124	833	1	719
CBK76130.1	1.75e-187	124	833	1	719
QHB25117.1	5.13e-186	16	827	15	813

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	9.83e-120	302	826	366	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.09e-87	275	834	292	848	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000200_02093.